PDB entry 6eng

View 6eng on RCSB PDB site
Description: Crystal structure of the 43K ATPase domain of Escherichia coli gyrase B in complex with an aminocoumarin
Class: isomerase
Keywords: topoisomerase, gyrase b-aminocoumarin complex, isomerase
Deposited on 2017-10-04, released 2019-04-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-10, with a file datestamp of 2019-04-05.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA gyrase subunit b
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: gyrB, acrB, cou, himB, hisU, nalC, parA, pcbA, b3699, JW5625
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6enga1, d6enga2
  • Chain 'B':
    Compound: DNA gyrase subunit b
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: gyrB, acrB, cou, himB, hisU, nalC, parA, pcbA, b3699, JW5625
    Database cross-references and differences (RAF-indexed):
  • Heterogens: PO4, PG4, CL, NA, K, BHW, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6engA (A:)
    gphmsnsydsssikvlkgldavrkrpgmyigdtddgtglhhmvfevvdnaidealaghck
    eiivtihadnsvsvqddgrgiptgihpeegvsaaevimtvlhaggkfddnsykvsgglhg
    vgvsvvnalsqklelviqregkihrqiyehgvpqaplavtgetektgtmvrfwpsletft
    nvtefeyeilakrlrelsflnsgvsirlrdkrdgkedhfhyeggikafveylnknktpih
    pnifyfstekdgigvevalqwndgfqeniycftnnipqrdggthlagfraamtrtlnaym
    dkegyskkakvsatgddaregliavvsvkvpdpkfssqtkdklvssevksaveqqmnell
    aeyllenptdakivvgkiidaarareaarraremtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6engA (A:)
    vlkgldavrkrpgmyigdtddgtglhhmvfevvdnaidealaghckeiivtihadnsvsv
    qddgrgiptgihpeegvsaaevimtvlhaggkfddnsykvsgglhgvgvsvvnalsqkle
    lviqregkihrqiyehgvpqaplavtgetektgtmvrfwpsletftnvtefeyeilakrl
    relsflnsgvsirlrdkrdgkedhfhyeggikafveylnknktpihpnifyfstekdgig
    vevalqwndgfqeniycftnnipqrdggthlagfraamtrtlnaymdkegyskareglia
    vvsvkvpdpkfssqtkdklvssevksaveqqmnellaeyllenptdakivvgkiidaara
    reaarraremt
    

  • Chain 'B':
    No sequence available.