PDB entry 6ene

View 6ene on RCSB PDB site
Description: OmpF orthologue from Enterobacter cloacae (OmpE35)
Class: transport protein
Keywords: Porine OmpF-orthologue, Outer Membrane, transport protein
Deposited on 2017-10-04, released 2018-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-31, with a file datestamp of 2018-10-26.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoporin PhoE
    Species: Enterobacter cloacae [TaxId:550]
    Gene: BFJ73_07040
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6enea_
  • Chain 'B':
    Compound: Phosphoporin PhoE
    Species: Enterobacter cloacae [TaxId:550]
    Gene: BFJ73_07040
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6eneb_
  • Chain 'C':
    Compound: Phosphoporin PhoE
    Species: Enterobacter cloacae [TaxId:550]
    Gene: BFJ73_07040
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6enec_
  • Heterogens: SO4, BOG, C8E, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6eneA (A:)
    aeiynkdgnkldlygkavglhyfsdndgndgdktyarlgfkgetkindqltgygqweynf
    qgnnsegadaqsgnktrlafaglkfgdagsfdygrnyglvydaigitdmlpefggdtgvs
    dnffsgrtgglatyrnsgffglvdglnfgvqylgknertdalrsngdgwatslsydfdgf
    givgaygaadrtnaqqnlqwgkgdkaeqwatglkydanniylaalygemrnaarldngfa
    nktqdfsvvaqyqfdfglrpsiayykskakdvegigdedyinyidigatyyfnknmstyv
    dyqinqlkddnklginnddtvavglvyqf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6eneB (B:)
    aeiynkdgnkldlygkavglhyfsdndgndgdktyarlgfkgetkindqltgygqweynf
    qgnnsegadaqsgnktrlafaglkfgdagsfdygrnyglvydaigitdmlpefggdtgvs
    dnffsgrtgglatyrnsgffglvdglnfgvqylgknertdalrsngdgwatslsydfdgf
    givgaygaadrtnaqqnlqwgkgdkaeqwatglkydanniylaalygemrnaarldngfa
    nktqdfsvvaqyqfdfglrpsiayykskakdvegigdedyinyidigatyyfnknmstyv
    dyqinqlkddnklginnddtvavglvyqf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6eneC (C:)
    aeiynkdgnkldlygkavglhyfsdndgndgdktyarlgfkgetkindqltgygqweynf
    qgnnsegadaqsgnktrlafaglkfgdagsfdygrnyglvydaigitdmlpefggdtgvs
    dnffsgrtgglatyrnsgffglvdglnfgvqylgknertdalrsngdgwatslsydfdgf
    givgaygaadrtnaqqnlqwgkgdkaeqwatglkydanniylaalygemrnaarldngfa
    nktqdfsvvaqyqfdfglrpsiayykskakdvegigdedyinyidigatyyfnknmstyv
    dyqinqlkddnklginnddtvavglvyqf