PDB entry 6enc

View 6enc on RCSB PDB site
Description: LTA4 hydrolase in complex with Compound11
Class: hydrolase
Keywords: LTA4H, inhibitor, Hydrolase
Deposited on 2017-10-04, released 2017-12-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-13, with a file datestamp of 2017-12-08.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Leukotriene A-4 hydrolase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6enca1, d6enca2, d6enca3
  • Heterogens: ZN, ACT, YB, IMD, BGW, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6encA (A:)
    gpgpeivdtcslaspasvcrtkhlhlrcsvdftrrtltgtaaltvqsqednlrslvldtk
    dltiekvvingqevkyalgerqsykgspmeislpialsknqeivieisfetspkssalqw
    ltpeqtsgkehpylfsqcqaihcrailpcqdtpsvkltytaevsvpkelvalmsairdge
    tpdpedpsrkiykfiqkvpipcylialvvgalesrqigprtlvwsekeqveksayefset
    esmlkiaedlggpyvwgqydllvlppsfpyggmenpcltfvtptllagdkslsnviahei
    shswtgnlvtnktwdhfwlneghtvylerhicgrlfgekfrhfnalggwgelqnsvktfg
    ethpftklvvdltdidpdvayssvpyekgfallfyleqllggpeiflgflkayvekfsyk
    sittddwkdflysyfkdkvdvlnqvdwnawlyspglppikpnydmtltnacialsqrwit
    akeddlnsfnatdlkdlsshqlneflaqtlqraplplghikrmqevynfnainnseirfr
    wlrlciqskwedaiplalkmateqgrmkftrplfkdlaafdkshdqavrtyqehkasmhp
    vtamlvgkdlkvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6encA (A:)
    ivdtcslaspasvcrtkhlhlrcsvdftrrtltgtaaltvqsqednlrslvldtkdltie
    kvvingqevkyalgerqsykgspmeislpialsknqeivieisfetspkssalqwltpeq
    tsgkehpylfsqcqaihcrailpcqdtpsvkltytaevsvpkelvalmsairdgetpdpe
    dpsrkiykfiqkvpipcylialvvgalesrqigprtlvwsekeqveksayefsetesmlk
    iaedlggpyvwgqydllvlppsfpyggmenpcltfvtptllagdkslsnviaheishswt
    gnlvtnktwdhfwlneghtvylerhicgrlfgekfrhfnalggwgelqnsvktfgethpf
    tklvvdltdidpdvayssvpyekgfallfyleqllggpeiflgflkayvekfsyksittd
    dwkdflysyfkdkvdvlnqvdwnawlyspglppikpnydmtltnacialsqrwitakedd
    lnsfnatdlkdlsshqlneflaqtlqraplplghikrmqevynfnainnseirfrwlrlc
    iqskwedaiplalkmateqgrmkftrplfkdlaafdkshdqavrtyqehkasmhpvtaml
    vgkdlkvd