PDB entry 6ena

View 6ena on RCSB PDB site
Description: nemertide alpha-1
Deposited on 2017-10-04, released 2018-03-14
The last revision was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nemertide alpha-1
    Species: Lineus longissimus, synthetic [TaxId:88925]
    Database cross-references and differences (RAF-indexed):
    • PDB 6ENA (0-30)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6enaA (A:)
gciatgsfctlskgcctkncgwnfkcnppnq