PDB entry 6en4

View 6en4 on RCSB PDB site
Description: SF3b core in complex with a splicing modulator
Class: splicing
Keywords: Protein complex, splicing modulator, SPLICING
Deposited on 2017-10-04, released 2018-06-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-20, with a file datestamp of 2018-06-15.
Experiment type: XRAY
Resolution: 3.08 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Splicing factor 3B subunit 3
    Species: Homo sapiens [TaxId:9606]
    Gene: SF3B3, KIAA0017, SAP130
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15393 (2-1200)
      • expression tag (1)
      • expression tag (1201-1205)
  • Chain 'B':
    Compound: Splicing factor 3B subunit 5
    Species: Homo sapiens [TaxId:9606]
    Gene: SF3B5, SF3B10
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Splicing factor 3B subunit 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SF3B1, SAP155
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: PHD finger-like domain-containing protein 5A
    Species: Homo sapiens [TaxId:9606]
    Gene: PHF5A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6en4d_
  • Heterogens: ZN, BGZ

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6en4D (D:)
    gplgspgsramakhhpdlifcrkqagvaigrlcekcdgkcvicdsyvrpctlvricdecn
    ygsyqgrcvicggpgvsdayyckectiqekdrdgcpkivnlgssktdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6en4D (D:)
    pdlifcrkqagvaigrlcekcdgkcvicdsyvrpctlvricdecnygsyqgrcvicggpg
    vsdayyckectiqekdrdgcpkivnlgssktdl