PDB entry 6emr

View 6emr on RCSB PDB site
Description: solution structure of the ledgf/p75 ibd - iws1 (aa 446-548) complex
Deposited on 2017-10-03, released 2018-07-25
The last revision was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PC4 and SFRS1-interacting protein,Protein IWS1 homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: IWS1, IWS1L
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75475 (6-102)
      • expression tag (0-5)
    • Uniprot Q96ST2 (103-205)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6emrA (A:)
snaaswetsmdsrlqrihaeiknslkidnldvnrciealdelaslqvtmqqaqkhtemit
tlkkirrfkvsqvimekstmlynkfknmflvgegdsvitqvlnkelsdkkneekdlfgsd
sesgneeenliadifgesgdeeeeeftgfnqedleeekgetqvkeaedsdsddnikrgkh
mdflsdfemmlqrkksmsgkrrrnrd