PDB entry 6emq

View 6emq on RCSB PDB site
Description: solution structure of the ledgf/p75 ibd - mll1 (aa 111-160) complex
Deposited on 2017-10-03, released 2018-08-01
The last revision was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PC4 and SFRS1-interacting protein,Histone-lysine N-methyltransferase 2A
    Species: Homo sapiens [TaxId:9606]
    Gene: KMT2A, ALL1, CXXC7, HRX, HTRX, MLL, MLL1, TRX1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75475 (6-104)
      • expression tag (0-5)
      • linker (105-113)
    • Uniprot Q03164 (114-164)
      • linker (114)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6emqA (A:)
snaaswetsmdsrlqrihaeiknslkidnldvnrciealdelaslqvtmqqaqkhtemit
tlkkirrfkvsqvimekstmlynkfknmflvgegdsvitqvlnksggsgsgsgssgfdaa
lqvsaaigtnlrrfravfgesgggggsgedeqflgfgsdeevrvr