PDB entry 6emp

View 6emp on RCSB PDB site
Description: solution structure of the ledgf/p75 ibd - pogz (aa 1370-1404) complex
Deposited on 2017-10-03, released 2018-07-25
The last revision was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PC4 and SFRS1-interacting protein,Pogo transposable element with ZNF domain
    Species: Homo sapiens [TaxId:9606]
    Gene: POGZ, KIAA0461, SUHW5, ZNF280E, ZNF635, Nbla00003
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75475 (6-103)
      • expression tag (0-5)
    • Uniprot Q7Z3K3 (104-138)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6empA (A:)
snaaswetsmdsrlqrihaeiknslkidnldvnrciealdelaslqvtmqqaqkhtemit
tlkkirrfkvsqvimekstmlynkfknmflvgegdsvitqvlnkrprsspeetiepeslh
qlfegesetesfygfeead