PDB entry 6emo

View 6emo on RCSB PDB site
Description: solution structure of the ledgf/p75 ibd - jpo2 (aa 1-32) complex
Deposited on 2017-10-03, released 2018-07-25
The last revision was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PC4 and SFRS1-interacting protein,LEDGF/p75 IBD-JPO2 M1
    Species: Homo sapiens [TaxId:9606]
    Gene: PSIP1, DFS70, LEDGF, PSIP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75475 (6-103)
      • expression tag (0-5)
    • Uniprot Q96GN5 (104-135)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6emoA (A:)
snaaswetsmdsrlqrihaeiknslkidnldvnrciealdelaslqvtmqqaqkhtemit
tlkkirrfkvsqvimekstmlynkfknmflvgegdsvitqvlnkmelatryqipkevadi
fnapsddeefvgfrdd