PDB entry 6emi

View 6emi on RCSB PDB site
Description: Crystal structure of a variant of human butyrylcholinesterase expressed in bacteria.
Class: hydrolase
Keywords: alpha-beta hydrolase, prokaryotic expression, dimeric form, disulfide bond., HYDROLASE
Deposited on 2017-10-02, released 2017-11-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.48 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cholinesterase
    Species: Homo sapiens [TaxId:9606]
    Gene: BCHE, CHE1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06276 (Start-531)
      • engineered mutation (9)
      • engineered mutation (50)
      • engineered mutation (56)
      • engineered mutation (68)
      • engineered mutation (73)
      • engineered mutation (112-113)
      • engineered mutation (128)
      • engineered mutation (178)
      • engineered mutation (182)
      • engineered mutation (190)
      • engineered mutation (192-193)
      • engineered mutation (217)
      • engineered mutation (229)
      • engineered mutation (236)
      • engineered mutation (238-239)
      • engineered mutation (252)
      • engineered mutation (276)
      • engineered mutation (285)
      • engineered mutation (307)
      • engineered mutation (344)
      • engineered mutation (358)
      • engineered mutation (362)
      • engineered mutation (379)
      • engineered mutation (381-382)
      • engineered mutation (389)
      • engineered mutation (392-393)
      • engineered mutation (399)
      • engineered mutation (408)
      • engineered mutation (411-412)
      • engineered mutation (414)
      • engineered mutation (419)
      • engineered mutation (456)
      • engineered mutation (461)
      • engineered mutation (468)
      • engineered mutation (470-471)
      • engineered mutation (491)
      • engineered mutation (497)
      • engineered mutation (510)
      • engineered mutation (520)
      • engineered mutation (525)
    Domains in SCOPe 2.06: d6emia_
  • Chain 'B':
    Compound: cholinesterase
    Species: Homo sapiens [TaxId:9606]
    Gene: BCHE, CHE1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06276 (Start-531)
      • engineered mutation (9)
      • engineered mutation (50)
      • engineered mutation (56)
      • engineered mutation (68)
      • engineered mutation (73)
      • engineered mutation (112-113)
      • engineered mutation (128)
      • engineered mutation (178)
      • engineered mutation (182)
      • engineered mutation (190)
      • engineered mutation (192-193)
      • engineered mutation (217)
      • engineered mutation (229)
      • engineered mutation (236)
      • engineered mutation (238-239)
      • engineered mutation (252)
      • engineered mutation (276)
      • engineered mutation (285)
      • engineered mutation (307)
      • engineered mutation (344)
      • engineered mutation (358)
      • engineered mutation (362)
      • engineered mutation (379)
      • engineered mutation (381-382)
      • engineered mutation (389)
      • engineered mutation (392-393)
      • engineered mutation (399)
      • engineered mutation (408)
      • engineered mutation (411-412)
      • engineered mutation (414)
      • engineered mutation (419)
      • engineered mutation (456)
      • engineered mutation (461)
      • engineered mutation (468)
      • engineered mutation (470-471)
      • engineered mutation (491)
      • engineered mutation (497)
      • engineered mutation (510)
      • engineered mutation (520)
      • engineered mutation (525)
    Domains in SCOPe 2.06: d6emib_
  • Heterogens: EDO, PEG, CL, PGE, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6emiA (A:)
    gameddiiittkngkvrgmnltvfggtvtaflgipyaqpplgrlrfkkpqpltkwsgiwn
    atkyanscmqnidtsfpgfhgsemwnpntdlsedclylnvwipapkpknatvmvwiyggg
    fqtgtsslpvydgkflarvervivvsmnyrvgalgflalpgnpeapgnmglfdqqlalkw
    vqdniaafggdpnrvtlfgesagaasvslhllspgshplftrailqsgsanapwavmspe
    earnrtlnlakllgcsreneteiikclrnkdpqeildneafvvpystplsvnfgptvdgd
    fltdmpdtllelgqfkktqilvgvnkdegtaflvygapgfskdndsiitrkefqeglkvf
    fpnvsefgkesilfhytdwededrpenyrdalaevvgdyfficpalefakkyaehgnnay
    fyyfehrssklpwpewmgvmhgyeiefvfglplerrlnytkeeeilsreimrrwanfaky
    gnpnetqnnstqwpvfkpteqkyltlntessrimtklraqhcrfwnsffpkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6emiA (A:)
    diiittkngkvrgmnltvfggtvtaflgipyaqpplgrlrfkkpqpltkwsgiwnatkya
    nscmqnidtsfpgfhgsemwnpntdlsedclylnvwipapkpknatvmvwiygggfqtgt
    sslpvydgkflarvervivvsmnyrvgalgflalpgnpeapgnmglfdqqlalkwvqdni
    aafggdpnrvtlfgesagaasvslhllspgshplftrailqsgsanapwavmspeearnr
    tlnlakllgcsreneteiikclrnkdpqeildneafvvpystplsvnfgptvdgdfltdm
    pdtllelgqfkktqilvgvnkdegtaflvygapgfskdndsiitrkefqeglkvffpnvs
    efgkesilfhytdwededrpenyrdalaevvgdyfficpalefakkyaehgnnayfyyfe
    hrssklpwpewmgvmhgyeiefvfglplerrlnytkeeeilsreimrrwanfakygnpne
    tqnnstqwpvfkpteqkyltlntessrimtklraqhcrfwnsffpkv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6emiB (B:)
    gameddiiittkngkvrgmnltvfggtvtaflgipyaqpplgrlrfkkpqpltkwsgiwn
    atkyanscmqnidtsfpgfhgsemwnpntdlsedclylnvwipapkpknatvmvwiyggg
    fqtgtsslpvydgkflarvervivvsmnyrvgalgflalpgnpeapgnmglfdqqlalkw
    vqdniaafggdpnrvtlfgesagaasvslhllspgshplftrailqsgsanapwavmspe
    earnrtlnlakllgcsreneteiikclrnkdpqeildneafvvpystplsvnfgptvdgd
    fltdmpdtllelgqfkktqilvgvnkdegtaflvygapgfskdndsiitrkefqeglkvf
    fpnvsefgkesilfhytdwededrpenyrdalaevvgdyfficpalefakkyaehgnnay
    fyyfehrssklpwpewmgvmhgyeiefvfglplerrlnytkeeeilsreimrrwanfaky
    gnpnetqnnstqwpvfkpteqkyltlntessrimtklraqhcrfwnsffpkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6emiB (B:)
    diiittkngkvrgmnltvfggtvtaflgipyaqpplgrlrfkkpqpltkwsgiwnatkya
    nscmqnidtsfpgfhgsemwnpntdlsedclylnvwipapkpknatvmvwiygggfqtgt
    sslpvydgkflarvervivvsmnyrvgalgflalpgnpeapgnmglfdqqlalkwvqdni
    aafggdpnrvtlfgesagaasvslhllspgshplftrailqsgsanapwavmspeearnr
    tlnlakllgcsreneteiikclrnkdpqeildneafvvpystplsvnfgptvdgdfltdm
    pdtllelgqfkktqilvgvnkdegtaflvygapgfskdndsiitrkefqeglkvffpnvs
    efgkesilfhytdwededrpenyrdalaevvgdyfficpalefakkyaehgnnayfyyfe
    hrssklpwpewmgvmhgyeiefvfglplerrlnytkeeeilsreimrrwanfakygnpne
    tqnnstqwpvfkpteqkyltlntessrimtklraqhcrfwnsffpkv