PDB entry 6emh

View 6emh on RCSB PDB site
Description: Crystal structure of JNK3 in complex with a pyridinylimidazole inhibitor
Class: transferase
Keywords: Protein Kinase Activity Map Kinase Activity ATP Binding Protein Phosphorylation, TRANSFERASE
Deposited on 2017-10-02, released 2018-08-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-10-16, with a file datestamp of 2019-10-11.
Experiment type: XRAY
Resolution: 1.7600000000000002 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 10
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK10, JNK3, JNK3A, PRKM10, SAPK1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6emha_
  • Chain 'B':
    Compound: Mitogen-activated protein kinase 10
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK10, JNK3, JNK3A, PRKM10, SAPK1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6emhb_
  • Chain 'C':
    Compound: Mitogen-activated protein kinase 10
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK10, JNK3, JNK3A, PRKM10, SAPK1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6emhc_
  • Chain 'D':
    Compound: Mitogen-activated protein kinase 10
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK10, JNK3, JNK3A, PRKM10, SAPK1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6emhd_
  • Heterogens: BGE, BME, CL, EDO, C15, PEG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6emhA (A:)
    ggsmskskvdnqfysvevgdstftvlkryqnlkpigsgaqgivcaaydavldrnvaikkl
    srpfqnqthakrayrelvlmkcvnhkniisllnvftpqktleefqdvylvmelmdanlcq
    viqmeldhermsyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglartag
    tsfmmtpyvvtryyrapevilgmgykenvdiwsvgcimgemvrhkilfpgrdyidqwnkv
    ieqlgtpcpefmkklqptvrnyvenrpkyagltfpklfpdslfpadsehnklkasqardl
    lskmlvidpakrisvddalqhpyinvwydpaeveapppqiydkqlderehtieewkeliy
    kevmnse
    

    Sequence, based on observed residues (ATOM records): (download)
    >6emhA (A:)
    nqfysvevgdstftvlkryqnlkpiivcaaydavldrnvaikklsrpfqnqthakrayre
    lvlmkcvnhkniisllnvftpqktleefqdvylvmelmdanlcqviqmeldhermsylly
    qmlcgikhlhsagiihrdlkpsnivvksdctlkildfglartagtsfmvtryyrapevil
    gmgykenvdiwsvgcimgemvrhkilfpgrdyidqwnkvieqlgtpcpefmkklqptvrn
    yvenrpkyagltfpklfpdslfpadsehnklkasqardllskmlvidpakrisvddalqh
    pyinvwydpaeveapppqiydkqlderehtieewkeliykevmn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6emhB (B:)
    ggsmskskvdnqfysvevgdstftvlkryqnlkpigsgaqgivcaaydavldrnvaikkl
    srpfqnqthakrayrelvlmkcvnhkniisllnvftpqktleefqdvylvmelmdanlcq
    viqmeldhermsyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglartag
    tsfmmtpyvvtryyrapevilgmgykenvdiwsvgcimgemvrhkilfpgrdyidqwnkv
    ieqlgtpcpefmkklqptvrnyvenrpkyagltfpklfpdslfpadsehnklkasqardl
    lskmlvidpakrisvddalqhpyinvwydpaeveapppqiydkqlderehtieewkeliy
    kevmnse
    

    Sequence, based on observed residues (ATOM records): (download)
    >6emhB (B:)
    nqfysvevgdstftvlkryqnlkpiivcaaydavldrnvaikklsrpfqnqthakrayre
    lvlmkcvnhkniisllnvftpqktleefqdvylvmelmdanlcqviqmeldhermsylly
    qmlcgikhlhsagiihrdlkpsnivvksdctlkildfglartagtsfmvtryyrapevil
    gmgykenvdiwsvgcimgemvrhkilfpgrdyidqwnkvieqlgtpcpefmkklqptvrn
    yvenrpkyagltfpklfpdslfpadsehnklkasqardllskmlvidpakrisvddalqh
    pyinvwydpaeveapppqiydkqlderehtieewkeliykevmn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6emhC (C:)
    ggsmskskvdnqfysvevgdstftvlkryqnlkpigsgaqgivcaaydavldrnvaikkl
    srpfqnqthakrayrelvlmkcvnhkniisllnvftpqktleefqdvylvmelmdanlcq
    viqmeldhermsyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglartag
    tsfmmtpyvvtryyrapevilgmgykenvdiwsvgcimgemvrhkilfpgrdyidqwnkv
    ieqlgtpcpefmkklqptvrnyvenrpkyagltfpklfpdslfpadsehnklkasqardl
    lskmlvidpakrisvddalqhpyinvwydpaeveapppqiydkqlderehtieewkeliy
    kevmnse
    

    Sequence, based on observed residues (ATOM records): (download)
    >6emhC (C:)
    nqfysvevgdstftvlkryqnlkpigivcaaydavldrnvaikklsrpfqnqthakrayr
    elvlmkcvnhkniisllnvftpqktleefqdvylvmelmdanlcqviqmeldhermsyll
    yqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglartavtryyrapevilgmgy
    kenvdiwsvgcimgemvrhkilfpgrdyidqwnkvieqlgtpcpefmkklqptvrnyven
    rpkyagltfpklfpdslfpadsehnklkasqardllskmlvidpakrisvddalqhpyin
    vwydpaeveapppqiydehtieewkeliykevmn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6emhD (D:)
    ggsmskskvdnqfysvevgdstftvlkryqnlkpigsgaqgivcaaydavldrnvaikkl
    srpfqnqthakrayrelvlmkcvnhkniisllnvftpqktleefqdvylvmelmdanlcq
    viqmeldhermsyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglartag
    tsfmmtpyvvtryyrapevilgmgykenvdiwsvgcimgemvrhkilfpgrdyidqwnkv
    ieqlgtpcpefmkklqptvrnyvenrpkyagltfpklfpdslfpadsehnklkasqardl
    lskmlvidpakrisvddalqhpyinvwydpaeveapppqiydkqlderehtieewkeliy
    kevmnse
    

    Sequence, based on observed residues (ATOM records): (download)
    >6emhD (D:)
    nqfysvevgdstftvlkryqnlkpigivcaaydavldrnvaikklsrpfqnqthakrayr
    elvlmkcvnhkniisllnvftpqktleefqdvylvmelmdanlcqviqmeldhermsyll
    yqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglartatryyrapevilgmgyk
    envdiwsvgcimgemvrhkilfpgrdyidqwnkvieqlgtpcpefmkklqptvrnyvenr
    pkyagltfpklfpdslfpadsehnklkasqardllskmlvidpakrisvddalqhpyinv
    wydpaeveapppqiehtieewkeliykevmn