PDB entry 6ely

View 6ely on RCSB PDB site
Description: Crystal Structure of Mistletoe Lectin I (ML-I) from Viscum album in Complex with 4-N-Furfurylcytosine at 2.84 A Resolution
Class: hydrolase
Keywords: Ribosome-inactivating protein, Mistletoe lectin, Viscum album L., 4-N-Furfurylcytosine, HYDROLASE
Deposited on 2017-09-30, released 2018-05-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-02, with a file datestamp of 2018-04-27.
Experiment type: XRAY
Resolution: 2.84 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mistletoe lectin I
    Species: Viscum album [TaxId:3972]
    Database cross-references and differences (RAF-indexed):
    • PDB 6ELY (0-248)
    Domains in SCOPe 2.07: d6elya_
  • Chain 'B':
    Compound: mistletoe lectin I
    Species: Viscum album [TaxId:3972]
    Database cross-references and differences (RAF-indexed):
    • PDB 6ELY (0-262)
    Domains in SCOPe 2.07: d6elyb1, d6elyb2
  • Heterogens: NAG, CL, SO4, GOL, GLY, BFW, GLA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6elyA (A:)
    yerlslrtvqqttgaeyfsfitllrdfvssgsfsnnipllrqstipvsegsrfvlveltn
    aggdsvtaaidvtnlyvvayqagqqsyflkdapagaetqdftgttrsslpfngsypdler
    yaghrdqiplgidqliqsvtalrfpggstrtqarsililiqmiseaarfdpilwrarqyi
    nsgasflpdvymleletswgqqstqvqhstdgvfnnpirlalspgnvvtltnvrdviasl
    aimlfvcge
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6elyB (B:)
    ddvtcsaseptvrivgrngmtvdvrdddfqdgnqiqlwpsksnndpnqlwtikkdgtirs
    ngsclttygytagvyvmifdcntavreatiwqiwgngtiinprsnlvlaassgikgttlt
    vqtldytlgqgwlagndtaprevtiygfrdlcmesaggsvwvetctagqenqrwalygdg
    sirpkqnqsqcltngrdsvstvinivscsagssgqrwvftnagailnlknglamdvaqan
    palariiiypatgnpnqmwlpvp