PDB entry 6elw

View 6elw on RCSB PDB site
Description: High resolution structure of selenocysteine containing human GPX4
Class: oxidoreductase
Keywords: human gpx4, peroxidase, selenoprotein, thioredoxin-fold, anti-oxidatve defense system, oxidoreductase
Deposited on 2017-09-29, released 2018-06-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-20, with a file datestamp of 2018-06-15.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phospholipid hydroperoxide glutathione peroxidase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: GPX4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36969 (Start-191)
      • engineered mutation (31)
      • engineered mutation (58)
      • engineered mutation (87)
      • engineered mutation (96)
      • engineered mutation (128)
      • engineered mutation (169)
    Domains in SCOPe 2.07: d6elwa_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6elwA (A:)
    mgsshhhhhhssglvprgshmleaasrddwraarsmhefsakdidghmvnldkyrgfvsi
    vtnvasqxgktevnytqlvdlharyaeaglrilafpsnqfgkqepgsneeikefaagynv
    kfdmfskiavngddahplwkwmkiqpkgkgilgnaikwnftkflidkngavvkrygpmee
    plviekdlphyf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6elwA (A:)
    ddwraarsmhefsakdidghmvnldkyrgfvsivtnvasqxgktevnytqlvdlharyae
    aglrilafpsnqfgkqepgsneeikefaagynvkfdmfskiavngddahplwkwmkiqpk
    gkgilgnaikwnftkflidkngavvkrygpmeeplviekdlphyf