PDB entry 6elt

View 6elt on RCSB PDB site
Description: c-terminal domain of mdppo1 upon self-cleavage (ccleaved-domain)
Deposited on 2017-09-29, released 2019-03-20
The last revision was dated 2019-05-29, with a file datestamp of 2019-05-24.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polyphenol oxidase, chloroplastic
    Species: Malus domestica [TaxId:3750]
    Database cross-references and differences (RAF-indexed):
    • PDB 6ELT
  • Heterogens: CA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6eltA (A:)
    kvvagtefpislgskistvvkrpkqkkrskkakedeeeilviegiefdrdvavkfdvyvn
    dvddlpsgpdktefagsfvsvphshkhkkkmntilrlgltdlleeieaedddsvvvtlvp
    kfgavkiggikiefas
    

    Sequence, based on observed residues (ATOM records):
    >6eltA (A:)
    vvagtefpislgskistvvkrpkqkkrskkakedeeeilviegiefdrdvavkfdvyvnd
    vddlpsgpdktefagsfvsvphshkhkkkmntilrlgltdlleeieaedddsvvvtlvpk
    fgavkiggikief