PDB entry 6eln

View 6eln on RCSB PDB site
Description: Estimation of relative drug-target residence times by random acceleration molecular dynamics simulation
Class: chaperone
Keywords: chaperone protein, ATP binding, chaperone
Deposited on 2017-09-29, released 2018-05-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-07-18, with a file datestamp of 2018-07-13.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heat shock protein HSP 90-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: HSP90AA1, HSP90A, HSPC1, HSPCA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6elna_
  • Heterogens: P4A, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6elnA (A:)
    vetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgkel
    hinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfgv
    gfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqte
    yleerrikeivkkhsqfigypitlfve