PDB entry 6elm

View 6elm on RCSB PDB site
Description: crystal structure of the human wnk2 cct1 domain
Deposited on 2017-09-29, released 2017-12-20
The last revision was dated 2019-10-16, with a file datestamp of 2019-10-11.
Experiment type: XRAY
Resolution: 1.14 Å
R-factor: N/A
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase WNK2
    Species: Homo sapiens [TaxId:9606]
    Gene: WNK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y3S1 (2-97)
      • expression tag (0-1)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6elmA (A:)
smaedtgvrvelaeedhgrkstialrlwvedpkklkgkpkdngaieftfdleketpdeva
qemiesgffhesdvkivaksirdrvaliqwrreriwpa