PDB entry 6elg

View 6elg on RCSB PDB site
Description: Tryptophan Repressor TrpR from E.coli variant M42F T44L T81I S88Y with Indole-3-acetonitrile
Class: transcription
Keywords: Ligand Binding, TRANSCRIPTION
Deposited on 2017-09-28, released 2019-02-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-04-07, with a file datestamp of 2021-04-02.
Experiment type: XRAY
Resolution: 1.38 Å
R-factor: N/A
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trp operon repressor
    Species: Escherichia coli [TaxId:562]
    Gene: trpR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A881
      • engineered mutation (41)
      • engineered mutation (43)
      • engineered mutation (80)
      • engineered mutation (87)
    Domains in SCOPe 2.08: d6elga_
  • Chain 'B':
    Compound: trp operon repressor
    Species: Escherichia coli [TaxId:562]
    Gene: trpR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A881
      • engineered mutation (41)
      • engineered mutation (43)
      • engineered mutation (80)
      • engineered mutation (87)
    Domains in SCOPe 2.08: d6elgb_
  • Heterogens: 3BO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6elgA (A:)
maqqspysaamaeqrhqewlrfvdllknayqndlhlpllnlfllpderealgtrvrivee
llrgemsqrelknelgagiaiitrgsnylkaapvelrqwleevllksdlehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >6elgA (A:)
aqqspysaamaeqrhqewlrfvdllknayqndlhlpllnlfllpderealgtrvriveel
lrgemsqrelknelgagiaiitrgsnylkaapvelrqwleevllk

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >6elgB (B:)
maqqspysaamaeqrhqewlrfvdllknayqndlhlpllnlfllpderealgtrvrivee
llrgemsqrelknelgagiaiitrgsnylkaapvelrqwleevllksdlehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >6elgB (B:)
qqspysaamaeqrhqewlrfvdllknayqndlhlpllnlfllpderealgtrvriveell
rgemsqrelknelgagiaiitrgsnylkaapvelrqwleevllk