PDB entry 6eld

View 6eld on RCSB PDB site
Description: crystal structure of tia-1 rrm1 in complex with u1c
Deposited on 2017-09-28, released 2018-10-24
The last revision was dated 2018-10-24, with a file datestamp of 2018-10-19.
Experiment type: XRAY
Resolution: 2.49 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleolysin TIA-1 isoform p40,U1 small nuclear ribonucleoprotein C
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPC
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6eldA (A:)
gamedempktlyvgnlsrdvtealilqlfsqigpcknckmimdtagndpycfvefhehrh
aaaalaamngrkimgkevkvnwattpssqkkdtsgsggsggsggsggsghkenvkdyyqk
wmeeqaqslidkttaafqqgk

    Sequence, based on observed residues (ATOM records):
    >6eldA (A:)
edempktlyvgnlsrdvtealilqlfsqigpcknckmigndpycfvefhehrhaaaalaa
mngrkimgkevkvnwattpsnvkdyyqkwmeeqaqslidkttaafqq