PDB entry 6elb

View 6elb on RCSB PDB site
Description: Tryptophan Repressor TrpR from E.coli variant M42F T44L T81M N87G S88Y with Indole-3-acetic acid as ligand
Class: transcription
Keywords: Ligand Binding, TRANSCRIPTION
Deposited on 2017-09-28, released 2019-02-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-04-07, with a file datestamp of 2021-04-02.
Experiment type: XRAY
Resolution: 1.44 Å
R-factor: N/A
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trp operon repressor
    Species: Escherichia coli [TaxId:562]
    Gene: trpR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A881
      • engineered mutation (41)
      • engineered mutation (43)
      • engineered mutation (80)
      • engineered mutation (86-87)
    Domains in SCOPe 2.08: d6elba_
  • Chain 'B':
    Compound: trp operon repressor
    Species: Escherichia coli [TaxId:562]
    Gene: trpR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A881
      • engineered mutation (41)
      • engineered mutation (43)
      • engineered mutation (80)
      • engineered mutation (86-87)
    Domains in SCOPe 2.08: d6elbb_
  • Heterogens: IAC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6elbA (A:)
maqqspysaamaeqrhqewlrfvdllknayqndlhlpllnlfllpderealgtrvrivee
llrgemsqrelknelgagiamitrgsgylkaapvelrqwleevllksdlehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >6elbA (A:)
aqqspysaamaeqrhqewlrfvdllknayqndlhlpllnlfllpderealgtrvriveel
lrgemsqrelknelgagiamitrgsgylkaapvelrqwleevllk

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >6elbB (B:)
maqqspysaamaeqrhqewlrfvdllknayqndlhlpllnlfllpderealgtrvrivee
llrgemsqrelknelgagiamitrgsgylkaapvelrqwleevllksdlehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >6elbB (B:)
aqqspysaamaeqrhqewlrfvdllknayqndlhlpllnlfllpderealgtrvriveel
lrgemsqrelknelgagiamitrgsgylkaapvelrqwleevllk