PDB entry 6el8

View 6el8 on RCSB PDB site
Description: crystal structure of the forkhead domain of human foxn1 in complex with dna
Deposited on 2017-09-28, released 2017-11-15
The last revision was dated 2018-04-11, with a file datestamp of 2018-04-06.
Experiment type: XRAY
Resolution: 1.61 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Forkhead box protein N1
    Species: Homo sapiens [TaxId:9606]
    Gene: FOXN1, RONU, WHN
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15353 (2-End)
      • expression tag (1)
  • Chain 'B':
    Compound: DNA (5'-d(*gp*gp*tp*gp*gp*cp*gp*tp*cp*tp*tp*cp*a)-3')
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
  • Chain 'C':
    Compound: DNA (5'-d(*tp*gp*ap*ap*gp*ap*cp*gp*cp*cp*ap*cp*c)-3')
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
  • Chain 'D':
    Compound: Forkhead box protein N1
    Species: Homo sapiens [TaxId:9606]
    Gene: FOXN1, RONU, WHN
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15353 (2-End)
      • expression tag (0-1)
  • Chain 'E':
    Compound: DNA (5'-d(*gp*gp*tp*gp*gp*cp*gp*tp*cp*tp*tp*cp*a)-3')
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
  • Chain 'F':
    Compound: DNA (5'-d(*tp*gp*ap*ap*gp*ap*cp*gp*cp*cp*ap*cp*c)-3')
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6el8A (A:)
smpkpiysysilifmalknsktgslpvseiynfmtehfpyfktapdgwknsvrhnlslnk
cfekvenksgsssrkgclwalnpakidkmqeelqkwkrk

    Sequence, based on observed residues (ATOM records):
    >6el8A (A:)
mpkpiysysilifmalknsktgslpvseiynfmtehfpyfktapdgwknsvrhnlslnkc
fekvenkskgclwalnpakidkmqeelqk

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records:
    >6el8D (D:)
smpkpiysysilifmalknsktgslpvseiynfmtehfpyfktapdgwknsvrhnlslnk
cfekvenksgsssrkgclwalnpakidkmqeelqkwkrk

    Sequence, based on observed residues (ATOM records):
    >6el8D (D:)
smpkpiysysilifmalknsktgslpvseiynfmtehfpyfktapdgwknsvrhnlslnk
cfekvekgclwalnpakidkmqeelqkwk

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.