PDB entry 6el6

View 6el6 on RCSB PDB site
Description: glucocorticoid receptor in complex with compound 4
Deposited on 2017-09-28, released 2018-02-21
The last revision was dated 2018-03-21, with a file datestamp of 2018-03-16.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucocorticoid receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: NR3C1, GRL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04150
      • engineered mutation (73)
      • engineered mutation (104)
      • engineered mutation (140)
  • Chain 'B':
    Compound: nuclear receptor coactivator 2
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: EDO, B9Q, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6el6A (A:)
    gsiqqattgvsqetsenpgdktivpatlpqltptlvslleviepevlyagydssvpdstw
    rimttlnmlggrqmiaavkwakaipgfrnlhlddqmtllqyswmslmafalgwrsyrqss
    anllcfapdliineqrmtlpdmydqckhmlyvsselhrlqvsyeeylcmktllllssvpk
    dglksqelfdeirmtyikelgkaivkregnssqnwqrfyqltklldsmhevvenllnycf
    qtfldktmsiefpemlaeiitnqipkysngnikkllfhqk
    

    Sequence, based on observed residues (ATOM records):
    >6el6A (A:)
    ptlvslleviepevlyagydssvpdstwrimttlnmlggrqmiaavkwakaipgfrnlhl
    ddqmtllqyswmslmafalgwrsyrqssanllcfapdliineqrmtlpdmydqckhmlyv
    sselhrlqvsyeeylcmktllllssvpkdglksqelfdeirmtyikelgkaivkregnss
    qnwqrfyqltklldsmhevvenllnycfqtfldktmsiefpemlaeiitnqipkysngni
    kkllfhq
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6el6B (B:)
    kenallrylldkdd
    

    Sequence, based on observed residues (ATOM records):
    >6el6B (B:)
    enallrylldkdd