PDB entry 6el4

View 6el4 on RCSB PDB site
Description: direct-evolutioned unspecific peroxygenase from agrocybe aegerita, in complex with veratryl alcohol
Deposited on 2017-09-27, released 2018-12-12
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.53 Å
R-factor: N/A
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aromatic peroxygenase
    Species: Agrocybe aegerita [TaxId:5400]
    Gene: APO1
    Database cross-references and differences (RAF-indexed):
    • Uniprot B9W4V6
      • engineered mutation (56)
      • engineered mutation (66)
      • engineered mutation (74)
      • engineered mutation (247)
      • engineered mutation (310)
  • Heterogens: HEM, MG, CL, NAG, PO4, GOL, VOH, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6el4A (A:)
    epglppgplenssaklvndeahpwkplrpgdirgpcpglntlashgylprngvatpaqii
    navqegfnfdnqaaifatyaahlvdgnlitdllsigrktrltgpdppppasvgglnehgt
    fegdasmtrgdaffgnnhdfnetlfeqlvdysnrfgggkynltvagelrfkriqdsiatn
    pnfsfvdfrfftaygettfpanlfvdgrrddgqldmdaarsffqfsrmpddffrapsprs
    gtgvevvvqahpmqpgrnvgkinsytvdptssdfstpclmyekfvnitvkslypnptvql
    rkalntnldflfqgvaagctqvfpygrd
    

    Sequence, based on observed residues (ATOM records):
    >6el4A (A:)
    pglppgplenssaklvndeahpwkplrpgdirgpcpglntlashgylprngvatpaqiin
    avqegfnfdnqaaifatyaahlvdgnlitdllsigrktrltgpdppppasvgglnehgtf
    egdasmtrgdaffgnnhdfnetlfeqlvdysnrfgggkynltvagelrfkriqdsiatnp
    nfsfvdfrfftaygettfpanlfvdgrrddgqldmdaarsffqfsrmpddffrapsprsg
    tgvevvvqahpmqpgrnvgkinsytvdptssdfstpclmyekfvnitvkslypnptvqlr
    kalntnldflfqgvaagctqvfpygr