PDB entry 6ekq

View 6ekq on RCSB PDB site
Description: Crystal structure of the human BRPF1 bromodomain complexed with BZ054 in space group C2
Class: DNA binding protein
Keywords: Bromodomain and PHD finger-containing protein 1(BRPF1), monocytic leukemia zinc-finger (MOZ), Inhibitor, transcription, DNA binding protein
Deposited on 2017-09-26, released 2018-06-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-06-27, with a file datestamp of 2018-06-22.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peregrin
    Species: Homo sapiens [TaxId:9606]
    Gene: BRPF1, BR140
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55201 (1-115)
      • expression tag (0)
    Domains in SCOPe 2.08: d6ekqa1, d6ekqa2
  • Chain 'B':
    Compound: Peregrin
    Species: Homo sapiens [TaxId:9606]
    Gene: BRPF1, BR140
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6ekqb_
  • Heterogens: B0H, NO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ekqA (A:)
    smemqltpflillrktleqlqekdtgnifsepvplsevpdyldhikkpmdfftmkqnlea
    yrylnfddfeedfnlivsnclkynakdtifyraavrlreqggavlrqarrqaekmg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ekqB (B:)
    smemqltpflillrktleqlqekdtgnifsepvplsevpdyldhikkpmdfftmkqnlea
    yrylnfddfeedfnlivsnclkynakdtifyraavrlreqggavlrqarrqaekmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ekqB (B:)
    qltpflillrktleqlqekdtgnifsepvplsevpdyldhikkpmdfftmkqnleayryl
    nfddfeedfnlivsnclkynakdtifyraavrlreqggavlrqarrqaekmg