PDB entry 6ekp

View 6ekp on RCSB PDB site
Description: Tryptophan Repressor TrpR from E.coli variant T44L T81M S88Y with Indole-3-acetic acid as ligand
Class: transcription
Keywords: Ligand Binding, TRANSCRIPTION
Deposited on 2017-09-26, released 2019-01-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-04-07, with a file datestamp of 2021-04-02.
Experiment type: XRAY
Resolution: 1.46 Å
R-factor: N/A
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trp operon repressor
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: trpR, rtrY, b4393, JW4356
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A881
      • engineered mutation (43)
      • engineered mutation (80)
      • engineered mutation (87)
    Domains in SCOPe 2.08: d6ekpa_
  • Chain 'B':
    Compound: trp operon repressor
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: trpR, rtrY, b4393, JW4356
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A881
      • engineered mutation (43)
      • engineered mutation (80)
      • engineered mutation (87)
    Domains in SCOPe 2.08: d6ekpb_
  • Heterogens: IAC, P3G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ekpA (A:)
    maqqspysaamaeqrhqewlrfvdllknayqndlhlpllnlmllpderealgtrvrivee
    llrgemsqrelknelgagiamitrgsnylkaapvelrqwleevllksdlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ekpA (A:)
    qspysaamaeqrhqewlrfvdllknayqndlhlpllnlmllpderealgtrvriveellr
    gemsqrelknelgagiamitrgsnylkaapvelrqwleevll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ekpB (B:)
    maqqspysaamaeqrhqewlrfvdllknayqndlhlpllnlmllpderealgtrvrivee
    llrgemsqrelknelgagiamitrgsnylkaapvelrqwleevllksdlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ekpB (B:)
    qqspysaamaeqrhqewlrfvdllknayqndlhlpllnlmllpderealgtrvriveell
    rgemsqrelknelgagiamitrgsnylkaapvelrqwleevllk