PDB entry 6ekk

View 6ekk on RCSB PDB site
Description: Crystal structure of GEF domain of DENND 1A in complex with Rab GTPase Rab35-GDP bound state.
Class: transcription
Keywords: DENND1A- DENN domain-containing protein 1A RAB35- Ras-related protein Rab-35, transcription
Deposited on 2017-09-26, released 2018-10-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-10-17, with a file datestamp of 2018-10-12.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DENN domain-containing protein 1A
    Species: Homo sapiens [TaxId:9606]
    Gene: DENND1A, FAM31A, KIAA1608
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: DENN domain-containing protein 1A
    Species: Homo sapiens [TaxId:9606]
    Gene: DENND1A, FAM31A, KIAA1608
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Ras-related protein Rab-35
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB35, RAB1C, RAY
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6ekkc_
  • Chain 'D':
    Compound: Ras-related protein Rab-35
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB35, RAB1C, RAY
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6ekkd_
  • Heterogens: SO4, EDO, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6ekkC (C:)
rdydhlfklliigdsgvgksslllrfadntfsgsyittigvdfkirtveingekvklqiw
dtagqerfrtitstyyrgthgvivvydvtsaesfvnvkrwlheinqncddvcrilvgnkn
ddperkvvetedaykfagqmgiqlfetsakenvnveemfncitelvlrakkdnlak

  • Chain 'D':
    Sequence, based on SEQRES records: (download) 
    >6ekkD (D:)
rdydhlfklliigdsgvgksslllrfadntfsgsyittigvdfkirtveingekvklqiw
dtagqerfrtitstyyrgthgvivvydvtsaesfvnvkrwlheinqncddvcrilvgnkn
ddperkvvetedaykfagqmgiqlfetsakenvnveemfncitelvlrakkdnlak

    Sequence, based on observed residues (ATOM records): (download) 
    >6ekkD (D:)
dydhlfklliigdsgvgksslllrfadntfsgsyittigvdfkirtveingekvklqiwd
tagqerfrtitstyyrgthgvivvydvtsaesfvnvkrwlheinqncddvcrilvgnknd
dperkvvetedaykfagqmgiqlfetsakenvnveemfncitelvlrakkdnla