PDB entry 6eki

View 6eki on RCSB PDB site
Description: Structure of a hyperthermostable carbonic anhydrase identified from an active hydrothermal vent chimney
Class: lyase
Keywords: carbonic anhydrase, thermostability, metagenomics, lyase
Deposited on 2017-09-26, released 2018-04-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-11, with a file datestamp of 2018-04-06.
Experiment type: XRAY
Resolution: 2.56 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carbonic anhydrase
    Species: Persephonella marina [TaxId:309805]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EKI (Start-225)
    Domains in SCOPe 2.07: d6ekia_
  • Chain 'B':
    Compound: carbonic anhydrase
    Species: Persephonella marina [TaxId:309805]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EKI (Start-225)
    Domains in SCOPe 2.07: d6ekib_
  • Chain 'C':
    Compound: carbonic anhydrase
    Species: Persephonella marina [TaxId:309805]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EKI (Start-225)
    Domains in SCOPe 2.07: d6ekic_
  • Chain 'D':
    Compound: carbonic anhydrase
    Species: Persephonella marina [TaxId:309805]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EKI (Start-225)
    Domains in SCOPe 2.07: d6ekid_
  • Chain 'E':
    Compound: carbonic anhydrase
    Species: Persephonella marina [TaxId:309805]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EKI (Start-225)
    Domains in SCOPe 2.07: d6ekie_
  • Chain 'F':
    Compound: carbonic anhydrase
    Species: Persephonella marina [TaxId:309805]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EKI (Start-225)
    Domains in SCOPe 2.07: d6ekif_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ekiA (A:)
    ggvghwsyhgetgpqhwgdlkneyimckigknqspvdisriveaelekikinyssggssi
    tnnghtikvsyepgsyiivdgirfelkqfhfhapsehtikgksypfeahfvhadkdgnla
    vigvifkegkknpiiekiwenlpeagktiklahkinaydllpkkkkyyrysgslttppcs
    egvrwivmeeemelskeqiekfrklmggdtnrpvqplnarmimemd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ekiA (A:)
    hwsyhgetgpqhwgdlkneyimckigknqspvdisriveaelekikinyssggssitnng
    htikvsyepgsyiivdgirfelkqfhfhapsehtikgksypfeahfvhadkdgnlavigv
    ifkegkknpiiekiwenlpeagktiklahkinaydllpkkkkyyrysgslttppcsegvr
    wivmeeemelskeqiekfrklmggdtnrpvqplnarmimemd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ekiB (B:)
    ggvghwsyhgetgpqhwgdlkneyimckigknqspvdisriveaelekikinyssggssi
    tnnghtikvsyepgsyiivdgirfelkqfhfhapsehtikgksypfeahfvhadkdgnla
    vigvifkegkknpiiekiwenlpeagktiklahkinaydllpkkkkyyrysgslttppcs
    egvrwivmeeemelskeqiekfrklmggdtnrpvqplnarmimemd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ekiB (B:)
    hwsyhgetgpqhwgdlkneyimckigknqspvdisriveaelekikinyssggssitnng
    htikvsyepgsyiivdgirfelkqfhfhapsehtikgksypfeahfvhadkdgnlavigv
    ifkegkknpiiekiwenlpeagktiklahkinaydllpkkkkyyrysgslttppcsegvr
    wivmeeemelskeqiekfrklmggdtnrpvqplnarmimemd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6ekiC (C:)
    ggvghwsyhgetgpqhwgdlkneyimckigknqspvdisriveaelekikinyssggssi
    tnnghtikvsyepgsyiivdgirfelkqfhfhapsehtikgksypfeahfvhadkdgnla
    vigvifkegkknpiiekiwenlpeagktiklahkinaydllpkkkkyyrysgslttppcs
    egvrwivmeeemelskeqiekfrklmggdtnrpvqplnarmimemd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ekiC (C:)
    hwsyhgetgpqhwgdlkneyimckigknqspvdisriveaelekikinyssggssitnng
    htikvsyepgsyiivdgirfelkqfhfhapsehtikgksypfeahfvhadkdgnlavigv
    ifkegkknpiiekiwenlpeagktiklahkinaydllpkkkkyyrysgslttppcsegvr
    wivmeeemelskeqiekfrklmggdtnrpvqplnarmimemd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6ekiD (D:)
    ggvghwsyhgetgpqhwgdlkneyimckigknqspvdisriveaelekikinyssggssi
    tnnghtikvsyepgsyiivdgirfelkqfhfhapsehtikgksypfeahfvhadkdgnla
    vigvifkegkknpiiekiwenlpeagktiklahkinaydllpkkkkyyrysgslttppcs
    egvrwivmeeemelskeqiekfrklmggdtnrpvqplnarmimemd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ekiD (D:)
    hwsyhgetgpqhwgdlkneyimckigknqspvdisriveaelekikinyssggssitnng
    htikvsyepgsyiivdgirfelkqfhfhapsehtikgksypfeahfvhadkdgnlavigv
    ifkegkknpiiekiwenlpeagktiklahkinaydllpkkkkyyrysgslttppcsegvr
    wivmeeemelskeqiekfrklmggdtnrpvqplnarmimemd
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6ekiE (E:)
    ggvghwsyhgetgpqhwgdlkneyimckigknqspvdisriveaelekikinyssggssi
    tnnghtikvsyepgsyiivdgirfelkqfhfhapsehtikgksypfeahfvhadkdgnla
    vigvifkegkknpiiekiwenlpeagktiklahkinaydllpkkkkyyrysgslttppcs
    egvrwivmeeemelskeqiekfrklmggdtnrpvqplnarmimemd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ekiE (E:)
    hwsyhgetgpqhwgdlkneyimckigknqspvdisriveaelekikinyssggssitnng
    htikvsyepgsyiivdgirfelkqfhfhapsehtikgksypfeahfvhadkdgnlavigv
    ifkegkknpiiekiwenlpeagktiklahkinaydllpkkkkyyrysgslttppcsegvr
    wivmeeemelskeqiekfrklmggdtnrpvqplnarmimemd
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6ekiF (F:)
    ggvghwsyhgetgpqhwgdlkneyimckigknqspvdisriveaelekikinyssggssi
    tnnghtikvsyepgsyiivdgirfelkqfhfhapsehtikgksypfeahfvhadkdgnla
    vigvifkegkknpiiekiwenlpeagktiklahkinaydllpkkkkyyrysgslttppcs
    egvrwivmeeemelskeqiekfrklmggdtnrpvqplnarmimemd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ekiF (F:)
    hwsyhgetgpqhwgdlkneyimckigknqspvdisriveaelekikinyssggssitnng
    htikvsyepgsyiivdgirfelkqfhfhapsehtikgksypfeahfvhadkdgnlavigv
    ifkegkknpiiekiwenlpeagktiklahkinaydllpkkkkyyrysgslttppcsegvr
    wivmeeemelskeqiekfrklmggdtnrpvqplnarmimemd