PDB entry 6eke

View 6eke on RCSB PDB site
Description: crystal structure of a pholiota squarrosa lectin unliganded
Deposited on 2017-09-26, released 2018-07-11
The last revision was dated 2018-08-29, with a file datestamp of 2018-08-24.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lectin
    Species: Pholiota squarrosa [TaxId:75321]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EKE
  • Chain 'B':
    Compound: lectin
    Species: Pholiota squarrosa [TaxId:75321]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EKE
  • Chain 'C':
    Compound: lectin
    Species: Pholiota squarrosa [TaxId:75321]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EKE (0-42)
  • Heterogens: ZN, ACT, BU1, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6ekeA (A:)
gamapvpvtklvcdgdtykctayldfgdgrwvaqwdtnvfhtg

    Sequence, based on observed residues (ATOM records):
    >6ekeA (A:)
klvcdgdtykctayldfgdgrwvaqwdtnvfht

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6ekeB (B:)
gamapvpvtklvcdgdtykctayldfgdgrwvaqwdtnvfhtg

    Sequence, based on observed residues (ATOM records):
    >6ekeB (B:)
mapvpvtklvcdgdtykctayldfgdgrwvaqwdtnvfht

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >6ekeC (C:)
gamapvpvtklvcdgdtykctayldfgdgrwvaqwdtnvfhtg