PDB entry 6ekb

View 6ekb on RCSB PDB site
Description: crystal structure of the bsd2 homolog of arabidopsis thaliana
Deposited on 2017-09-26, released 2017-12-06
The last revision was dated 2017-12-20, with a file datestamp of 2017-12-15.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DnaJ/Hsp40 cysteine-rich domain superfamily protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: F1P2.200, At3g47650
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6ekbA (A:)
maannnpqgtkpnslvcancegegcvacsqckgggvnlidhfngqfkagalcwlcrgkke
vlcgdcngagfiggflstfde

    Sequence, based on observed residues (ATOM records):
    >6ekbA (A:)
nslvcancegegcvacsqckgggvnlidhfngqfkagalcwlcrgkkevlcgdcngagfi
gg