PDB entry 6ek9

View 6ek9 on RCSB PDB site
Description: cytosolic copper storage protein csp from streptomyces lividans: cu loaded form
Deposited on 2017-09-25, released 2018-08-08
The last revision was dated 2018-08-08, with a file datestamp of 2018-08-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytosolic copper storage protein
    Species: Streptomyces lividans [TaxId:1916]
    Gene: SLIV_21385
    Database cross-references and differences (RAF-indexed):
    • Uniprot D6ES11 (0-120)
      • conflict (34)
  • Heterogens: CU1, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6ek9A (A:)
lggvdreamarcieeclrcaqactacadaclsepavadltkcirtdmdcadvctataavl
srhtgydanvtravlqacatvcaacgdecarhagmhehcrvcaeacrsceqacqellagl
g