PDB entry 6ek2

View 6ek2 on RCSB PDB site
Description: crystal structure of human cd81 large extracellular loop in complex with single chain fv fragment 10
Class: cell adhesion
Keywords: helical bundle, antibody-antigen complex, cell adhesion
Deposited on 2017-09-25, released 2018-05-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-30, with a file datestamp of 2018-05-25.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CD81 antigen
    Species: Homo sapiens [TaxId:9606]
    Gene: CD81, TAPA1, TSPAN28
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60033 (Start-91)
      • expression tag (92)
    Domains in SCOPe 2.07: d6ek2a1, d6ek2a2
  • Chain 'B':
    Compound: CD81 antigen
    Species: Homo sapiens [TaxId:9606]
    Gene: CD81, TAPA1, TSPAN28
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ek2b_
  • Chain 'H':
    Compound: single chain fv fragment
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EK2 (0-246)
    Domains in SCOPe 2.07: d6ek2h1, d6ek2h2
  • Chain 'I':
    Compound: single chain fv fragment
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EK2 (0-246)
    Domains in SCOPe 2.07: d6ek2i1, d6ek2i2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ek2A (A:)
    gsgfvnkdqiakdvkqfydqalqqavvdddannakavvktfhetldccgsstltalttsv
    lknnlcpsgsniisnlfkedchqkiddlfsgkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ek2A (A:)
    fvnkdqiakdvkqfydqalqqavvdddannakavvktfhetldccgsstltalttsvlkn
    nlcpsgsniisnlfkedchqkiddlfsgkh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ek2B (B:)
    gsgfvnkdqiakdvkqfydqalqqavvdddannakavvktfhetldccgsstltalttsv
    lknnlcpsgsniisnlfkedchqkiddlfsgkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ek2B (B:)
    fvnkdqiakdvkqfydqalqqavvdddannakavvktfhetldccgsstltalttsvlkn
    nlcpsgsniisnlfkedchqkiddlfsgk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6ek2H (H:)
    evqlvesggglvkpggslklscaasgftfsdyymhwvrqtpkkrlewvatisdggsytyf
    ldsvkgrftisrdnaknkldlqmsslksedtgmyycardgnkysawfaywgqgtlvtvsa
    ggggsggggsggggsggggsdiqmtqssssfsvslgdrvtitckasediynrlawyqqkp
    gnaprllisgatsletgvpsrfsgsgsgkdytlsitslqtedfatyycqqywsppwtfgg
    gtkleik
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ek2H (H:)
    evqlvesggglvkpggslklscaasgftfsdyymhwvrqtpkkrlewvatisdggsytyf
    ldsvkgrftisrdnaknkldlqmsslksedtgmyycardgnkysawfaywgqgtlvtvsa
    diqmtqssssfsvslgdrvtitckasediynrlawyqqkpgnaprllisgatsletgvps
    rfsgsgsgkdytlsitslqtedfatyycqqywsppwtfgggtkleik
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >6ek2I (I:)
    evqlvesggglvkpggslklscaasgftfsdyymhwvrqtpkkrlewvatisdggsytyf
    ldsvkgrftisrdnaknkldlqmsslksedtgmyycardgnkysawfaywgqgtlvtvsa
    ggggsggggsggggsggggsdiqmtqssssfsvslgdrvtitckasediynrlawyqqkp
    gnaprllisgatsletgvpsrfsgsgsgkdytlsitslqtedfatyycqqywsppwtfgg
    gtkleik
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ek2I (I:)
    evqlvesggglvkpggslklscaasgftfsdyymhwvrqtpkkrlewvatisdggsytyf
    ldsvkgrftisrdnaknkldlqmsslksedtgmyycardgnkysawfaywgqgtlvtvsd
    iqmtqssssfsvslgdrvtitckasediynrlawyqqkpgnaprllisgatsletgvpsr
    fsgsgsgkdytlsitslqtedfatyycqqywsppwtfgggtkleik