PDB entry 6ejm

View 6ejm on RCSB PDB site
Description: crystal structure of human cd81 large extracellular loop in complex with single chain fv fragment 5
Class: cell adhesion
Keywords: helical bundle, antibody-antigen complex, cell adhesion
Deposited on 2017-09-22, released 2018-05-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-30, with a file datestamp of 2018-05-25.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CD81 antigen
    Species: Homo sapiens [TaxId:9606]
    Gene: CD81, TAPA1, TSPAN28
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60033 (Start-92)
      • expression tag (93-95)
    Domains in SCOPe 2.07: d6ejma1, d6ejma2
  • Chain 'B':
    Compound: CD81 antigen
    Species: Homo sapiens [TaxId:9606]
    Gene: CD81, TAPA1, TSPAN28
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60033 (Start-92)
      • expression tag (93)
    Domains in SCOPe 2.07: d6ejmb1, d6ejmb2
  • Chain 'H':
    Compound: single chain fv fragment
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EJM (Start-248)
    Domains in SCOPe 2.07: d6ejmh1, d6ejmh2
  • Chain 'I':
    Compound: single chain fv fragment
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EJM (Start-248)
    Domains in SCOPe 2.07: d6ejmi1, d6ejmi2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ejmA (A:)
    gsgfvnkdqiakdvkqfydqalqqavvdddannakavvktfhetldccgsstltalttsv
    lknnlcpsgsniisnlfkedchqkiddlfsgklhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ejmA (A:)
    fvnkdqiakdvkqfydqalqqavvdannakavvktfhetldccgsstltalttsvlknnl
    cpsgsniisnlfkedchqkiddlfsgklhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ejmB (B:)
    gsgfvnkdqiakdvkqfydqalqqavvdddannakavvktfhetldccgsstltalttsv
    lknnlcpsgsniisnlfkedchqkiddlfsgklhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ejmB (B:)
    fvnkdqiakdvkqfydqalqqavvdnnakavvktfhetldccgsstltalttsvlknnlc
    psgsniisnlfkedchqkiddlfsgklh
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6ejmH (H:)
    aevmlvesgggfvkpggslklscaasgftfrsyimswvrqtpekrlewvatisggggnty
    ypdsvkgrftisrdnakntlylqlsslrsedtalyycasltavgdywgqgtsvtvssggg
    gsggggsggggsggggsdvvmtqtpltlsvtigqpasisckssqslfdtdgktyltwllq
    rpgqspkrliylvsklasgvpdrftgsgsgtdftlkisrveaedlgvyyclqgthfpltf
    gagtkldlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ejmH (H:)
    vmlvesgggfvkpggslklscaasgftfrsyimswvrqtpekrlewvatisggggntyyp
    dsvkgrftisrdnakntlylqlsslrsedtalyycasltavgdywgqgtsvtvssggdvv
    mtqtpltlsvtigqpasisckssqslfdtdgktyltwllqrpgqspkrliylvsklasgv
    pdrftgsgsgtdftlkisrveaedlgvyyclqgthfpltfgagtkldlk
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >6ejmI (I:)
    aevmlvesgggfvkpggslklscaasgftfrsyimswvrqtpekrlewvatisggggnty
    ypdsvkgrftisrdnakntlylqlsslrsedtalyycasltavgdywgqgtsvtvssggg
    gsggggsggggsggggsdvvmtqtpltlsvtigqpasisckssqslfdtdgktyltwllq
    rpgqspkrliylvsklasgvpdrftgsgsgtdftlkisrveaedlgvyyclqgthfpltf
    gagtkldlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ejmI (I:)
    vmlvesgggfvkpggslklscaasgftfrsyimswvrqtpekrlewvatisggggntyyp
    dsvkgrftisrdnakntlylqlsslrsedtalyycasltavgdywgqgtsvtvssdvvmt
    qtpltlsvtigqpasisckssqslfdtdgktyltwllqrpgqspkrliylvsklasgvpd
    rftgsgsgtdftlkisrveaedlgvyyclqgthfpltfgagtkldlk