PDB entry 6eji

View 6eji on RCSB PDB site
Description: structure of a glycosyltransferase
Deposited on 2017-09-21, released 2018-02-07
The last revision was dated 2018-02-14, with a file datestamp of 2018-02-09.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: WlaC protein
    Species: Campylobacter jejuni [TaxId:197]
    Gene: wlaC
    Database cross-references and differences (RAF-indexed):
    • Uniprot O86151 (2-359)
      • initiating methionine (0)
      • expression tag (1)
  • Chain 'B':
    Compound: WlaC protein
    Species: Campylobacter jejuni [TaxId:197]
    Gene: wlaC
    Database cross-references and differences (RAF-indexed):
    • Uniprot O86151 (2-359)
      • initiating methionine (0)
      • expression tag (1)
  • Heterogens: UD2, K, GOL, NA, CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6ejiA (A:)
    mmmkisfiiatlnsggaervlvtlanalckehevsiikfhtgesfyklenevkvtsleqf
    rfdtlyhkiasrfkkffalrkalkeskadvfisfldttniacilaniglktpliisehsn
    eaylkpktwrflrrvsypfcdalsvlgssdkvyyerfvkrvklllnpchfsdeipfdssf
    ekenlvlfigrldhnknpvmflkaiahldknlqenykfviagdgelrqeleykvkslgik
    vdflgrvenvkalyekakvlclcsfveglptvlieslyfevcrisssyyngakdlikdnh
    dgllvgcddeialakklelvlndenfrkelvnnakqrckdfeisnikeewlklivevkna
    lgshhhhhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >6ejiA (A:)
    mmmkisfiiatlnsggaervlvtlanalckehevsiikfhtgesfyklenevkvtsleqf
    rfdtlyhkiasrfkkffalrkalkeskadvfisfldttniacilaniglktpliisehsn
    eaylkpktwrflrrvsypfcdalsvlgssdkvyyerfvkrvklllnpchfsdeipfdssf
    ekenlvlfigrldhnknpvmflkaiahldknlqenykfviagdgelrqeleykvkslgik
    vdflgrvenvkalyekakvlclcsfveglptvlieslyfevcrisssyyngakdlikdnh
    dgllvgcddeialakklelvlndenfrkelvnnakqrckdfeisnikeewlklivevkna
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6ejiB (B:)
    mmmkisfiiatlnsggaervlvtlanalckehevsiikfhtgesfyklenevkvtsleqf
    rfdtlyhkiasrfkkffalrkalkeskadvfisfldttniacilaniglktpliisehsn
    eaylkpktwrflrrvsypfcdalsvlgssdkvyyerfvkrvklllnpchfsdeipfdssf
    ekenlvlfigrldhnknpvmflkaiahldknlqenykfviagdgelrqeleykvkslgik
    vdflgrvenvkalyekakvlclcsfveglptvlieslyfevcrisssyyngakdlikdnh
    dgllvgcddeialakklelvlndenfrkelvnnakqrckdfeisnikeewlklivevkna
    lgshhhhhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >6ejiB (B:)
    mmmkisfiiatlnsggaervlvtlanalckehevsiikfhtgesfyklenevkvtsleqf
    rfdtlyhkiasrfkkffalrkalkeskadvfisfldttniacilaniglktpliisehsn
    eaylkpktwrflrrvsypfcdalsvlgssdkvyyerfvkrvklllnpchfsdeipfdssf
    ekenlvlfigrldhnknpvmflkaiahldknlqenykfviagdgelrqeleykvkslgik
    vdflgrvenvkalyekakvlclcsfveglptvlieslyfevcrisssyyngakdlikdnh
    dgllvgcddeialakklelvlndenfrkelvnnakqrckdfeisnikeewlklivevkna