PDB entry 6ejg

View 6ejg on RCSB PDB site
Description: crystal structure of human cd81 large extracellular loop in complex with single chain fv fragment 4
Class: cell adhesion
Keywords: helical bundle, antibody-antigen complex, cell adhesion
Deposited on 2017-09-21, released 2018-05-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-30, with a file datestamp of 2018-05-25.
Experiment type: XRAY
Resolution: 2.82 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CD81 antigen
    Species: Homo sapiens [TaxId:9606]
    Gene: CD81, TAPA1, TSPAN28
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ejga1, d6ejga2
  • Chain 'B':
    Compound: CD81 antigen
    Species: Homo sapiens [TaxId:9606]
    Gene: CD81, TAPA1, TSPAN28
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ejgb1, d6ejgb2
  • Chain 'C':
    Compound: single chain fv fragment
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EJG (0-250)
    Domains in SCOPe 2.07: d6ejgc1, d6ejgc2
  • Chain 'D':
    Compound: single chain fv fragment
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EJG (0-250)
    Domains in SCOPe 2.07: d6ejgd1, d6ejgd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ejgA (A:)
    gsgfvnkdqiakdvkqfydqalqqavvdddannakavvktfhetldccgsstltalttsv
    lknnlcpsgsniisnlfkedchqkiddlfsgklhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ejgA (A:)
    fvnkdqiakdvkqfydqalqqavvdddannakavvktfhetldccgsstltalttsvlkn
    nlcpsgsniisnlfkedchqkiddlfsgk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ejgB (B:)
    gsgfvnkdqiakdvkqfydqalqqavvdddannakavvktfhetldccgsstltalttsv
    lknnlcpsgsniisnlfkedchqkiddlfsgklhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ejgB (B:)
    fvnkdqiakdvkqfydqalqqavvdddannakavvktfhetldccgsstltalttsvlkn
    nlcpsgsniisnlfkedchqkiddlfsgk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6ejgC (C:)
    divltqspaslsvslgqratiscrasksvstsiysymhwyqqkpgqppkllikyasyles
    gvparfsgsgsgtdftlnihpveeedaatyycehsrefpftfgtgtkleikggggsgggg
    sggggsggggsqvqlqqsgpelvkpgasvkisckasgytfssswmnwvkqrpgkglewig
    riysgdgdaiyngkfkgkatltadkssstaymqlssltsedsavyfcaregktgdlllrs
    wgqgsaltvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ejgC (C:)
    divltqspaslsvslgqratiscrasksvstsiysymhwyqqkpgqppkllikyasyles
    gvparfsgsgsgtdftlnihpveeedaatyycehsrefpftfgtgtkleikqvqlqqsgp
    elvkpgasvkisckasgytfssswmnwvkqrpgkglewigriysgdgdaiyngkfkgkat
    ltadkssstaymqlssltsedsavyfcaregktgdlllrswgqgsaltvss
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6ejgD (D:)
    divltqspaslsvslgqratiscrasksvstsiysymhwyqqkpgqppkllikyasyles
    gvparfsgsgsgtdftlnihpveeedaatyycehsrefpftfgtgtkleikggggsgggg
    sggggsggggsqvqlqqsgpelvkpgasvkisckasgytfssswmnwvkqrpgkglewig
    riysgdgdaiyngkfkgkatltadkssstaymqlssltsedsavyfcaregktgdlllrs
    wgqgsaltvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ejgD (D:)
    divltqspaslsvslgqratiscrasksvstsiysymhwyqqkpgqppkllikyasyles
    gvparfsgsgsgtdftlnihpveeedaatyycehsrefpftfgtgtkleikqvqlqqsgp
    elvkpgasvkisckasgytfssswmnwvkqrpgkglewigriysgdgdaiyngkfkgkat
    ltadkssstaymqlssltsedsavyfcaregktgdlllrswgqgsaltvss