PDB entry 6eie

View 6eie on RCSB PDB site
Description: Ras guanine nucleotide exchange factor SOS2 (Rem-cdc25), with surface mutations
Class: signaling protein
Keywords: Guanine exchange factor, GEF, SOS2, SIGNALING PROTEIN
Deposited on 2017-09-19, released 2019-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-06, with a file datestamp of 2019-02-01.
Experiment type: XRAY
Resolution: 2.72 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Son of sevenless homolog 2
    Species: Homo sapiens [TaxId:9606]
    Gene: SOS2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07890 (4-End)
      • expression tag (3)
      • engineered mutation (6)
      • engineered mutation (149)
      • engineered mutation (210-211)
      • engineered mutation (389)
      • conflict (390)
      • engineered mutation (391)
      • engineered mutation (461)
    Domains in SCOPe 2.07: d6eiea1, d6eiea2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6eieA (A:)
    gamaeqqlrlpspevyrfvvkdseenivfednlqsrsgipiikggtvvklierltyhmya
    dpnfvrtflttyrsfckpqellsllierfeipepeptdadklaiekgeqpisadlkrfrk
    eyvqpvqlrilnvfrhwvehhfydferdlyllerlesfissvrgkamkkwvesiakiirr
    kkqaqangvshnitfesppppiewhiskpghietfdlmtlhpieiarqltllesdlyrkv
    qpselvgsvwtkedkeinspnllkmirhttnltlwfekciveaenfeervavlsriieil
    qvfqdlnnfngvleivsavnsvsvyrldhtfealqerkrkildeavelsqdhfkkylvkl
    ksinppcvpffgiyltnilkteegnndfltrhgkdlinfskrrkvaeitgeiqqyqnqpy
    clriepdmrrffenlnpmgsasekeftdylfnksleieprnpkqpprfprkstfslkspg
    irpntgrhgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eieA (A:)
    aeqqlrlpspevyrfvvkdseenivfeipiikggtvvklierltyhmyadpnfvrtfltt
    yrsfckpqellsllierfeipepeptdadklaieqpisadlkrfrkeyvqpvqlrilnvf
    rhwvehhfydferdlyllerlesfissvrgkamkkwvesiakiirrkkqaqsppppiewh
    iskpghietfdlmtlhpieiarqltllesdlyrkvqpselvgsvwtkedkeinspnllkm
    irhttnltlwfekciveaenfeervavlsriieilqvfqdlnnfngvleivsavnsvsvy
    rldhtfealqerkrkildeavelsqdhfkkylvklksinppcvpffgiyltnilkteegn
    ndfltrhlinfskrrkvaeitgeiqqyqnqpyclriepdmrrffenlnpmgsasekeftd
    ylfnksleieprnpkqpprfprkstfslkspgirp