PDB entry 6ei8

View 6ei8 on RCSB PDB site
Description: crystal structure of human trna-dihydrouridine (20) synthase dsrbd f359a mutant
Deposited on 2017-09-18, released 2018-10-10
The last revision was dated 2019-06-05, with a file datestamp of 2019-05-30.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tRNA-dihydrouridine(20) synthase [NAD(P)+]-like
    Species: Homo sapiens [TaxId:9606]
    Gene: DUS2, DUS2L
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NX74
      • engineered mutation (22)
  • Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6ei8A (A:)
mtseqtgepaedtsgvikmavkadrraypaqitpkmcllewcrreklaqpvyetvqrpld
rlfssivtvaeqkyqstlwdkskklaeqaaaivclrsqglpegrlgeespslhkhhhhhh

    Sequence, based on observed residues (ATOM records):
    >6ei8A (A:)
dtsgvikmavkadrraypaqitpkmcllewcrreklaqpvyetvqrpldrlfssivtvae
qkyqstlwdkskklaeqaaaivclrsqglpegrlgee