PDB entry 6ei5

View 6ei5 on RCSB PDB site
Description: Estimation of relative drug-target residence times by random acceleration molecular dynamics simulation
Class: chaperone
Keywords: chaperone protein, ATP binding, chaperone
Deposited on 2017-09-17, released 2018-05-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-10-16, with a file datestamp of 2019-10-11.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heat shock protein HSP 90-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: HSP90AA1, HSP90A, HSPC1, HSPCA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6ei5a_
  • Heterogens: B5Q, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6ei5A (A:)
eevetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgk
elhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqf
gvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedq
teyleerrikeivkkhsqfigypitlfve