PDB entry 6ei0

View 6ei0 on RCSB PDB site
Description: cytosolic copper storage protein csp from streptomyces lividans: apo form
Deposited on 2017-09-15, released 2018-10-10
The last revision was dated 2019-10-23, with a file datestamp of 2019-10-18.
Experiment type: XRAY
Resolution: 1.34 Å
R-factor: N/A
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'G':
    Compound: Cytosolic copper storage protein (Ccsp)
    Species: Streptomyces lividans 1326 [TaxId:1200984]
    Gene: SAMN05428941_3460
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: Cytosolic copper storage protein (Ccsp)
    Species: Streptomyces lividans 1326 [TaxId:1200984]
    Gene: SAMN05428941_3460
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: Cytosolic copper storage protein (Ccsp)
    Species: Streptomyces lividans 1326 [TaxId:1200984]
    Gene: SAMN05428941_3460
    Database cross-references and differences (RAF-indexed):
  • Chain 'U':
    Compound: Cytosolic copper storage protein (Ccsp)
    Species: Streptomyces lividans 1326 [TaxId:1200984]
    Gene: SAMN05428941_3460
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, GOL, PGE, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'G':
    Sequence, based on SEQRES records:
    >6ei0G (G:)
    ggvdreamarcieeclrcaqactacadaclseptvadltkcirtdmdcadvctataavls
    rhtgydanvtravlqacatvcaacgdecarhagmhehcrvcaeacrsceqacqellagl
    

    Sequence, based on observed residues (ATOM records):
    >6ei0G (G:)
    dreamarcieeclrcaqactacadaclseptvadltkcirtdmdcadvctataavlsrht
    gydanvtravlqacatvcaacgdecarhagmhehcrvcaeacrsceqacqellagl
    

  • Chain 'N':
    Sequence, based on SEQRES records:
    >6ei0N (N:)
    ggvdreamarcieeclrcaqactacadaclseptvadltkcirtdmdcadvctataavls
    rhtgydanvtravlqacatvcaacgdecarhagmhehcrvcaeacrsceqacqellagl
    

    Sequence, based on observed residues (ATOM records):
    >6ei0N (N:)
    vdreamarcieeclrcaqactacadaclseptvadltkcirtdmdcadvctataavlsrh
    tgydanvtravlqacatvcaacgdecarhagmhehcrvcaeacrsceqacqellagl
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records:
    >6ei0Q (Q:)
    ggvdreamarcieeclrcaqactacadaclseptvadltkcirtdmdcadvctataavls
    rhtgydanvtravlqacatvcaacgdecarhagmhehcrvcaeacrsceqacqellagl
    

  • Chain 'U':
    Sequence, based on SEQRES records:
    >6ei0U (U:)
    ggvdreamarcieeclrcaqactacadaclseptvadltkcirtdmdcadvctataavls
    rhtgydanvtravlqacatvcaacgdecarhagmhehcrvcaeacrsceqacqellagl
    

    Sequence, based on observed residues (ATOM records):
    >6ei0U (U:)
    dreamarcieeclrcaqactacadaclseptvadltkcirtdmdcadvctataavlsrht
    gydanvtravlqacatvcaacgdecarhagmhehcrvcaeacrsceqacqellagl