PDB entry 6ehz

View 6ehz on RCSB PDB site
Description: nmr solution structure of murine cxcl12 gamma isoform
Deposited on 2017-09-15, released 2018-10-10
The last revision was dated 2021-03-17, with a file datestamp of 2021-03-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Stromal cell-derived factor 1
    Species: Mus musculus [TaxId:10090]
    Gene: Cxcl12
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6ehzA (A:)
kpvslsyrcpcrffeshiaranvkhlkilntpncalqivarlknnnrqvcidpklkwiqe
ylekalnkgrreekvgkkekigkkkrqkkrkaaqkrkn