PDB entry 6ehs

View 6ehs on RCSB PDB site
Description: E. coli Hydrogenase-2 chemically reduced structure
Class: oxidoreductase
Keywords: Hydrogen oxidation, Membrane protein, NiFe Hydrogenase, OXIDOREDUCTASE
Deposited on 2017-09-15, released 2018-04-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-18, with a file datestamp of 2018-04-13.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'L':
    Compound: Hydrogenase-2 large chain
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: hybC, Z4348, ECs3879
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ehsl_
  • Chain 'M':
    Compound: Hydrogenase-2 large chain
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: hybC, Z4348, ECs3879
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ehsm_
  • Chain 'S':
    Compound: HybO protein
    Species: Escherichia coli [TaxId:585055]
    Gene: hybO, EC55989_3414
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ehss_
  • Chain 'T':
    Compound: HybO protein
    Species: Escherichia coli [TaxId:585055]
    Gene: hybO, EC55989_3414
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ehst_
  • Heterogens: SF4, F3S, FCO, NI, MG, DTN, HOH

PDB Chain Sequences:

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6ehsL (L:)
    msqritidpvtrieghlridceiengvvskawasgtmwrgmeeivknrdprdawmivqri
    cgvcttthalssvraaesalnidvpvnaqyirniilaahtthdhivhfyqlsaldwvdit
    salqadptkasemlkgvstwhlnspeeftkvqnkikdlvasgqlgifangywghpamklp
    pevnliavahylqalecqrdanrvvallggktphiqnlavggvanpinldglgvlnlerl
    myiksfidklsdfveqvykvdtaviaafypewltrgkgavnylsvpefptdskngsflfp
    ggyienadlssyrpitshsdeylikgiqesakhswykdeapqapwegttipaydgwsddg
    kyswvksptfygktvevgplanmlvklaagrestqnklneivaiyqkltgntlevaqlhs
    tlgriigrtvhccelqdilqnqysalitnigkgdhttfvkpnipatgefkgvgfleaprg
    mlshwmvikdgiisnyqavvpstwnsgprnfnddvgpyeqslvgtpvadpnkplevvrti
    hsfdpcmacavh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ehsL (L:)
    sqritidpvtrieghlridceiengvvskawasgtmwrgmeeivknrdprdawmivqric
    gvcttthalssvraaesalnidvpvnaqyirniilaahtthdhivhfyqlsaldwvdits
    alqadptkasemlkgvstwhlnspeeftkvqnkikdlvasgqlgifangywghpamklpp
    evnliavahylqalecqrdanrvvallggktphiqnlavggvanpinldglgvlnlerlm
    yiksfidklsdfveqvykvdtaviaafypewltrgkgavnylsvpefptdskngsflfpg
    gyienadlssyrpitshsdeylikgiqesakhswykdeapqapwegttipaydgwsddgk
    yswvksptfygktvevgplanmlvklaagrestqnklneivaiyqkltgntlevaqlhst
    lgriigrtvhccelqdilqnqysalitnigkgdhttfvkpnipatgefkgvgfleaprgm
    lshwmvikdgiisnyqavvpstwnsgprnfnddvgpyeqslvgtpvadpnkplevvrtih
    sfdpcmacavh
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >6ehsM (M:)
    msqritidpvtrieghlridceiengvvskawasgtmwrgmeeivknrdprdawmivqri
    cgvcttthalssvraaesalnidvpvnaqyirniilaahtthdhivhfyqlsaldwvdit
    salqadptkasemlkgvstwhlnspeeftkvqnkikdlvasgqlgifangywghpamklp
    pevnliavahylqalecqrdanrvvallggktphiqnlavggvanpinldglgvlnlerl
    myiksfidklsdfveqvykvdtaviaafypewltrgkgavnylsvpefptdskngsflfp
    ggyienadlssyrpitshsdeylikgiqesakhswykdeapqapwegttipaydgwsddg
    kyswvksptfygktvevgplanmlvklaagrestqnklneivaiyqkltgntlevaqlhs
    tlgriigrtvhccelqdilqnqysalitnigkgdhttfvkpnipatgefkgvgfleaprg
    mlshwmvikdgiisnyqavvpstwnsgprnfnddvgpyeqslvgtpvadpnkplevvrti
    hsfdpcmacavh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ehsM (M:)
    sqritidpvtrieghlridceiengvvskawasgtmwrgmeeivknrdprdawmivqric
    gvcttthalssvraaesalnidvpvnaqyirniilaahtthdhivhfyqlsaldwvdits
    alqadptkasemlkgvstwhlnspeeftkvqnkikdlvasgqlgifangywghpamklpp
    evnliavahylqalecqrdanrvvallggktphiqnlavggvanpinldglgvlnlerlm
    yiksfidklsdfveqvykvdtaviaafypewltrgkgavnylsvpefptdskngsflfpg
    gyienadlssyrpitshsdeylikgiqesakhswykdeapqapwegttipaydgwsddgk
    yswvksptfygktvevgplanmlvklaagrestqnklneivaiyqkltgntlevaqlhst
    lgriigrtvhccelqdilqnqysalitnigkgdhttfvkpnipatgefkgvgfleaprgm
    lshwmvikdgiisnyqavvpstwnsgprnfnddvgpyeqslvgtpvadpnkplevvrtih
    sfdpcmacavh
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >6ehsS (S:)
    memaesvtnpqrppviwigaqectgctesllrathptvenlvletisleyhevlsaafgh
    qveenkhnalekykgqyvlvvdgsiplkdngiycmvagepivdhirkaaegaaaiiaigs
    csawggvaaagvnptgavslqevlpgktvinipgcppnphnflatvahiitygkppkldd
    knrptfaygrlihehcerrphfdagrfakefgdeghregwclyhlgckgpetygncstlq
    fcdvggvwpvaighpcygcneegigfhkgihqlanvenqtprsqkpdvnakegghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ehsS (S:)
    qrppviwigaqectgctesllrathptvenlvletisleyhevlsaafghqveenkhnal
    ekykgqyvlvvdgsiplkdngiycmvagepivdhirkaaegaaaiiaigscsawggvaaa
    gvnptgavslqevlpgktvinipgcppnphnflatvahiitygkppklddknrptfaygr
    lihehcerrphfdagrfakefgdeghregwclyhlgckgpetygncstlqfcdvggvwpv
    aighpcygcneegigfhkgihqlanve
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >6ehsT (T:)
    memaesvtnpqrppviwigaqectgctesllrathptvenlvletisleyhevlsaafgh
    qveenkhnalekykgqyvlvvdgsiplkdngiycmvagepivdhirkaaegaaaiiaigs
    csawggvaaagvnptgavslqevlpgktvinipgcppnphnflatvahiitygkppkldd
    knrptfaygrlihehcerrphfdagrfakefgdeghregwclyhlgckgpetygncstlq
    fcdvggvwpvaighpcygcneegigfhkgihqlanvenqtprsqkpdvnakegghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ehsT (T:)
    pqrppviwigaqectgctesllrathptvenlvletisleyhevlsaafghqveenkhna
    lekykgqyvlvvdgsiplkdngiycmvagepivdhirkaaegaaaiiaigscsawggvaa
    agvnptgavslqevlpgktvinipgcppnphnflatvahiitygkppklddknrptfayg
    rlihehcerrphfdagrfakefgdeghregwclyhlgckgpetygncstlqfcdvggvwp
    vaighpcygcneegigfhkgihqlanve