PDB entry 6ehr

View 6ehr on RCSB PDB site
Description: The crystal structure of the human LAMTOR-RagA CTD-RagC CTD complex
Class: signaling protein
Keywords: Scaffolding complex, Rag-GTPases, mTOR, Ragulator, mTORC1, SIGNALING PROTEIN
Deposited on 2017-09-14, released 2017-10-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ragulator complex protein LAMTOR3
    Species: Homo sapiens [TaxId:9606]
    Gene: LAMTOR3, MAP2K1IP1, MAPKSP1, PRO2783
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ehra_
  • Chain 'B':
    Compound: Ragulator complex protein LAMTOR2
    Species: Homo sapiens [TaxId:9606]
    Gene: LAMTOR2, MAPBPIP, ROBLD3, HSPC003
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y2Q5 (2-125)
      • initiating methionine (0)
      • expression tag (1)
    Domains in SCOPe 2.07: d6ehrb_
  • Chain 'C':
    Compound: Ragulator complex protein LAMTOR5
    Species: Homo sapiens [TaxId:9606]
    Gene: LAMTOR5, HBXIP, XIP
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Ragulator complex protein LAMTOR4
    Species: Homo sapiens [TaxId:9606]
    Gene: LAMTOR4, C7orf59
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Ragulator complex protein LAMTOR1
    Species: Homo sapiens [TaxId:9606]
    Gene: LAMTOR1, C11orf59, PDRO, PP7157
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Ras-related GTP-binding protein A
    Species: Homo sapiens [TaxId:9606]
    Gene: RRAGA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7L523 (1-End)
      • expression tag (0)
  • Chain 'G':
    Compound: Ras-related GTP-binding protein C
    Species: Homo sapiens [TaxId:9606]
    Gene: RRAGC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HB90 (2-End)
      • expression tag (1)

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ehrA (A:)
    gahmaddlkrflykklpsveglhaivvsdrdgvpvikvandnapehalrpgflstfalat
    dqgsklglsknksiicyyntyqvvqfnrlplvvsfiasssantglivslekelaplfeel
    rqvvevs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ehrA (A:)
    ddlkrflykklpsveglhaivvsdrdgvpvikvandnapehalrpgflstfalatdqgsk
    lglsknksiicyyntyqvvqfnrlplvvsfiasssantglivslekelaplfeelrqvve
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ehrB (B:)
    mglrpkaltqvlsqantggvqstlllnnegsllaysgygdtdarvtaaiasniwaaydrn
    gnqafnednlkfilmdcmegrvaitrvanlllcmyaketvgfgmlkakaqalvqyleepl
    tqvaas
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.