PDB entry 6ehp

View 6ehp on RCSB PDB site
Description: The crystal structure of the human LAMTOR complex
Class: signaling protein
Keywords: Scaffolding complex, Rag-GTPase, mTOR, Ragulator, mTORC1, SIGNALING PROTEIN
Deposited on 2017-09-14, released 2017-10-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ragulator complex protein LAMTOR3
    Species: Homo sapiens [TaxId:9606]
    Gene: LAMTOR3, MAP2K1IP1, MAPKSP1, PRO2783
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d6ehpa_
  • Chain 'B':
    Compound: Ragulator complex protein LAMTOR2
    Species: Homo sapiens [TaxId:9606]
    Gene: LAMTOR2, MAPBPIP, ROBLD3, HSPC003
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d6ehpb_
  • Chain 'C':
    Compound: Ragulator complex protein LAMTOR5
    Species: Homo sapiens [TaxId:9606]
    Gene: LAMTOR5, HBXIP, XIP
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Ragulator complex protein LAMTOR4
    Species: Homo sapiens [TaxId:9606]
    Gene: LAMTOR4, C7orf59
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Ragulator complex protein LAMTOR1
    Species: Homo sapiens [TaxId:9606]
    Gene: LAMTOR1, C11orf59, PDRO, PP7157
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ehpA (A:)
    gahmaddlkrflykklpsveglhaivvsdrdgvpvikvandnapehalrpgflstfalat
    dqgsklglsknksiicyyntyqvvqfnrlplvvsfiasssantglivslekelaplfeel
    rqvvevs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ehpA (A:)
    maddlkrflykklpsveglhaivvsdrdgvpvikvandnapehalrpgflstfalatdqg
    sklglsknksiicyyntyqvvqfnrlplvvsfiasssantglivslekelaplfeelrqv
    ve
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ehpB (B:)
    mglrpkaltqvlsqantggvqstlllnnegsllaysgygdtdarvtaaiasniwaaydrn
    gnqafnednlkfilmdcmegrvaitrvanlllcmyaketvgfgmlkakaqalvqyleepl
    tqvaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ehpB (B:)
    pkaltqvlsqantggvqstlllnnegsllaysgygdtdarvtaaiasniwaaydrngnqd
    nlkfilmdcmegrvaitrvanlllcmyaketvgfgmlkakaqalvqyleepltqv
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.