PDB entry 6ehl

View 6ehl on RCSB PDB site
Description: model of the ebola virus nucleoprotein in recombinant nucleocapsid- like assemblies
Deposited on 2017-09-13, released 2017-11-08
The last revision was dated 2019-12-04, with a file datestamp of 2019-11-29.
Experiment type: EM
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nucleoprotein
    Species: Zaire ebolavirus (strain Mayinga-76) [TaxId:128952]
    Gene: NP
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6ehlA (A:)
    mdsrpqkiwmapsltesdmdyhkiltaglsvqqgivrqrvipvyqvnnleeicqliiqaf
    eagvdfqesadsfllmlclhhayqgdyklflesgavkyleghgfrfevkkrdgvkrleel
    lpavssgknikrtlaampeeetteanagqflsfaslflpklvvgekaclekvqrqiqvha
    eqgliqyptawqsvghmmvifrlmrtnflikfllihqgmhmvaghdandavisnsvaqar
    fsgllivktvldhilqktergvrlhplartakvknevnsfkaalsslakhgeyapfarll
    nlsgvnnlehglfpqlsaialgvatahgstlagvnvgeqyqqlreaateaekqlqqyaes
    reldhlglddqekkilmnfhqkkneisfqqtnamvtlrkerlaklteaitaaslpktsgh
    ydddddipfpgpindddnpghqdddptdsqdttipdvvvdpddgsygeyqsysengmnap
    ddlvlfdldeddedtkpvpnrstkggqqknsqkgqhiegrqtqsrpiqnvpgphrtihha
    sapltdndrrnepsgstsprmltpineeadplddaddetsslpplesddeeqdrdgtsnr
    tptvappapvyrdhsekkelpqdeqqdqdhtqearnqdsdntqsehsfeemyrhilrsqg
    pfdavlyyhmmkdepvvfstsdgkeytypdsleeeyppwltekeamneenrfvtldgqqf
    ywpvmnhknkfmailqhhq
    

    Sequence, based on observed residues (ATOM records):
    >6ehlA (A:)
    esdmdyhkiltaglsvqqgivrqrvipvyqvnnleeicqliiqafeagvdfqesadsfll
    mlclhhayqgdyklflesgavkyleghgfrfevkkrdgvkrleellpavssgknikrtla
    ampeeetteanagqflsfaslflpklvvgekaclekvqrqiqvhaeqgliqyptawqsvg
    hmmvifrlmrtnflikfllihqgmhmvaghdandavisnsvaqarfsgllivktvldhil
    qktergvrlhplartakvknevnsfkaalsslakhgeyapfarllnlsgvnnlehglfpq
    lsaialgvatahgstlagvnvgeqyqqlreaateaekqlqqyaesreldhlglddqekki
    lmnfhqkkneisfqqtnamvtlrkerlakl