PDB entry 6ehj

View 6ehj on RCSB PDB site
Description: Human N-myristoyltransferase (NMT1) with Myristoyl-CoA and peptide bound
Class: transferase
Keywords: Myristoylation, complex, substrate peptide, Transferase
Deposited on 2017-09-13, released 2019-03-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-27, with a file datestamp of 2019-03-22.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycylpeptide N-tetradecanoyltransferase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NMT1, NMT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ehja1, d6ehja2
  • Chain 'B':
    Compound: Glycylpeptide N-tetradecanoyltransferase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NMT1, NMT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ehjb1, d6ehjb2
  • Chain 'D':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Homo sapiens [TaxId:9606]
    Gene: SRC, SRC1
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Homo sapiens [TaxId:9606]
    Gene: SRC, SRC1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MG, GOL, COA, MYA, MYR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ehjA (A:)
    gphmeeaskrsyqfwdtqpvpklgevvnthgpvepdkdnirqepytlpqgftwdaldlgd
    rgvlkelytllnenyvedddnmfrfdyspefllwalrppgwlpqwhcgvrvvssrklvgf
    isaipanihiydtekkmveinflcvhkklrskrvapvlireitrrvhlegifqavytagv
    vlpkpvgtcrywhrslnprklievkfshlsrnmtmqrtmklyrlpetpktaglrpmetkd
    ipvvhqlltrylkqfhltpvmsqeevehwfypqeniidtfvvenangevtdflsfytlps
    timnhpthkslkaaysfynvhtqtplldlmsdalvlakmkgfdvfnaldlmenktflekl
    kfgigdgnlqyylynwkcpsmgaekvglvlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ehjA (A:)
    rsyqfwdtqpvpklgevvnthgpvepdkdnirqepytlpqgftwdaldlgdrgvlkelyt
    llnenyvdnmfrfdyspefllwalrppgwlpqwhcgvrvvssrklvgfisaipanihiyd
    tekkmveinflcvhkklrskrvapvlireitrrvhlegifqavytagvvlpkpvgtcryw
    hrslnprklievkfshlsmtmqrtmklyrlpetpktaglrpmetkdipvvhqlltrylkq
    fhltpvmsqeevehwfypqeniidtfvvenangevtdflsfytlpstikslkaaysfynv
    htqtplldlmsdalvlakmkgfdvfnaldlmenktfleklkfgigdgnlqyylynwkcps
    mgaekvglvlq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ehjB (B:)
    gphmeeaskrsyqfwdtqpvpklgevvnthgpvepdkdnirqepytlpqgftwdaldlgd
    rgvlkelytllnenyvedddnmfrfdyspefllwalrppgwlpqwhcgvrvvssrklvgf
    isaipanihiydtekkmveinflcvhkklrskrvapvlireitrrvhlegifqavytagv
    vlpkpvgtcrywhrslnprklievkfshlsrnmtmqrtmklyrlpetpktaglrpmetkd
    ipvvhqlltrylkqfhltpvmsqeevehwfypqeniidtfvvenangevtdflsfytlps
    timnhpthkslkaaysfynvhtqtplldlmsdalvlakmkgfdvfnaldlmenktflekl
    kfgigdgnlqyylynwkcpsmgaekvglvlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ehjB (B:)
    rsyqfwdtqpvpklgevvnthgpvepdkdnirqepytlpqgftwdaldlgdrgvlkelyt
    llnenyvedddnmfrfdyspefllwalrppgwlpqwhcgvrvvssrklvgfisaipanih
    iydtekkmveinflcvhkklrskrvapvlireitrrvhlegifqavytagvvlpkpvgtc
    rywhrslnprklievkfstmqrtmklyrlpetpktaglrpmetkdipvvhqlltrylkqf
    hltpvmsqeevehwfypqeniidtfvvenangevtdflsfytlpstimnhpthkslkaay
    sfynvhtqtplldlmsdalvlakmkgfdvfnaldlmenktfleklkfgigdgnlqyylyn
    wkcpsmgaekvglvlq
    

  • Chain 'D':
    No sequence available.

  • Chain 'F':
    No sequence available.