PDB entry 6ehb

View 6ehb on RCSB PDB site
Description: OmpU, an outer membrane protein, of Vibrio cholerae
Class: membrane protein
Keywords: Outer membrane protein, Porin, OmpF or OmpC ortholog, ion-transport, membrane beta barrel, ion-channel, membrane protein, diffusion porin, diffusion channel, non-specific porin.
Deposited on 2017-09-13, released 2018-04-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-25, with a file datestamp of 2018-04-20.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Outer membrane protein U
    Species: Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) [TaxId:345073]
    Gene: ompU, VC0395_A0162, VC395_0650
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ehba_
  • Chain 'B':
    Compound: Outer membrane protein U
    Species: Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) [TaxId:345073]
    Gene: ompU, VC0395_A0162, VC395_0650
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ehbb_
  • Chain 'C':
    Compound: Outer membrane protein U
    Species: Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) [TaxId:345073]
    Gene: ompU, VC0395_A0162, VC395_0650
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ehbc_
  • Heterogens: C8E, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ehbA (A:)
    dginqsgdkagstvysakgtslevggraearlslkdgkaqdnsrvrlnflgkaeindsly
    gvgfyegefttndqgknasnnsldnrytyagiggtygevtygkndgalgvitdftdimsy
    hgntaaekiavadrvdnmlaykgqfgdlgvkasyrfadrnavdamgnvvtetnaakysdn
    gedgyslsaiytfgdtgfnvgagyadqddqneymlaasyrmenlyfaglftdgelakdvd
    ytgyelaagyklgqaaftatynnaetakktsadnfaidatyyfkpnfrsyisyqfnllds
    dkaskvasedelaiglrydf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ehbA (A:)
    dginqsgdkagstvysakgtslevggraearlslkdgkaqdnsrvrlnflgkaeindsly
    gvgfyegefttndqgknasnnsldnrytyagiggtygevtygkndgalgvitdftdimsy
    hgntaaekiavadrvdnmlaykgqfgdlgvkasyrfadrnavdamgnvvtetnaakysdn
    gedgyslsaiytfgdtgfnvgagyadqddqneymlaasyrmenlyfaglftdgelakdvd
    ytgyelaagyklgqaaftatynnaetakktsadnfaidatyyfkpnfrsyisyqfnllds
    askvasedelaiglrydf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ehbB (B:)
    dginqsgdkagstvysakgtslevggraearlslkdgkaqdnsrvrlnflgkaeindsly
    gvgfyegefttndqgknasnnsldnrytyagiggtygevtygkndgalgvitdftdimsy
    hgntaaekiavadrvdnmlaykgqfgdlgvkasyrfadrnavdamgnvvtetnaakysdn
    gedgyslsaiytfgdtgfnvgagyadqddqneymlaasyrmenlyfaglftdgelakdvd
    ytgyelaagyklgqaaftatynnaetakktsadnfaidatyyfkpnfrsyisyqfnllds
    dkaskvasedelaiglrydf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ehbB (B:)
    dginqsgdkagstvysakgtslevggraearlslkdgkaqdnsrvrlnflgkaeindsly
    gvgfyegefttndqgknasnnsldnrytyagiggtygevtygkndgalgvitdftdimsy
    hgntaaekiavadrvdnmlaykgqfgdlgvkasyrfadrnavdamgnvvtetnaakysdn
    gedgyslsaiytfgdtgfnvgagyadqddqneymlaasyrmenlyfaglftdgelakdvd
    ytgyelaagyklgqaaftatynnaetakktsadnfaidatyyfkpnfrsyisyqfnllda
    skvasedelaiglrydf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ehbC (C:)
    dginqsgdkagstvysakgtslevggraearlslkdgkaqdnsrvrlnflgkaeindsly
    gvgfyegefttndqgknasnnsldnrytyagiggtygevtygkndgalgvitdftdimsy
    hgntaaekiavadrvdnmlaykgqfgdlgvkasyrfadrnavdamgnvvtetnaakysdn
    gedgyslsaiytfgdtgfnvgagyadqddqneymlaasyrmenlyfaglftdgelakdvd
    ytgyelaagyklgqaaftatynnaetakktsadnfaidatyyfkpnfrsyisyqfnllds
    dkaskvasedelaiglrydf