PDB entry 6eh8

View 6eh8 on RCSB PDB site
Description: HA1.7 Human T-Cell Receptor specific for Influenza virus epitope PKYVKQNTLKLAT presented by Human Leukocyte Antigen HLA-DR0101
Class: immune system
Keywords: Human T Cell Receptor, Human Leukocute Antigen, Influenza Haemagglutinin epitope, 3D structure, IMMUNE SYSTEM
Deposited on 2017-09-12, released 2018-04-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-18, with a file datestamp of 2018-04-13.
Experiment type: XRAY
Resolution: 2.51 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Human T Cell Receptor Alpha Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EH8 (0-200)
    Domains in SCOPe 2.07: d6eh8a1, d6eh8a2
  • Chain 'B':
    Compound: Human T Cell Receptor Beta Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EH8 (0-240)
    Domains in SCOPe 2.07: d6eh8b1, d6eh8b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6eh8A (A:)
    qsvtqlgshvsvsegalvllrcnysssvppylfwyvqypnqglqlllkytsaatlvkgin
    gfeaefkksetsfhltkpsahmsdaaeyfcavsespfgnekltfgtgtrltiipniqnpd
    pavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavaws
    nksdfacanafnnsiipedtf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6eh8B (B:)
    vkvtqssrylvkrtgekvflecvqdmdhenmfwyrqdpglglrliyfsydvkmkekgdip
    egysvsrekkerfslilesastnqtsmylcassstglpygytfgsgtrltvvedlnkvfp
    pevavfepseaeishtqkatlvclatgffpdhvelswwvngkevhsgvctdpqplkeqpa
    lndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgr
    a