PDB entry 6eh7

View 6eh7 on RCSB PDB site
Description: F11 Human T-Cell Receptor specific for influenza virus haaemagglutinin epitope PKYVKQNTLKLAT carried by Human Leukocyte Antigen HLA-DR0101
Class: immune system
Keywords: Human T Cell Receptor, Human Leukocute Antigen, Influenza Haemagglutinin epitope, 3D structure, IMMUNE SYSTEM
Deposited on 2017-09-12, released 2018-04-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-05-09, with a file datestamp of 2018-05-04.
Experiment type: XRAY
Resolution: 1.8900000000000001 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Human T Cell Receptor Alpha Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EH7 (0-201)
    Domains in SCOPe 2.08: d6eh7a1, d6eh7a2
  • Chain 'B':
    Compound: Human T Cell Receptor Beta Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EH7 (0-239)
    Domains in SCOPe 2.08: d6eh7b1, d6eh7b2
  • Heterogens: EDO, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6eh7A (A:)
    aqsvtqlgshvsvsegalvllrcnysssvppylfwyvqypnqglqlllkytsaatlvkgi
    ngfeaefkksetsfhltkpsahmsdaaeyfcavseqddkiifgkgtrlhilpniqnpdpa
    vyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnk
    sdfacanafnnsiipedtffps
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6eh7B (B:)
    advtqtprnritktgkrimlecsqtkghdrmywyrqdpglglrliyysfdvkdinkgeis
    dgysvsrqaqakfslslesaipnqtalyfcatsdesygytfgsgtrltvvedlnkvsppe
    vavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpaln
    dsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgrad