PDB entry 6eh4

View 6eh4 on RCSB PDB site
Description: 003 Human T-Cell Receptor specific for HIV GAG epitope SLYNTVATL carried by Human Leukocyte Antigen HLA-A*0201
Class: immune system
Keywords: Human T Cell Receptor, Human Leukocute Antigen, Influenza Haemagglutinin epitope, 3D structure, IMMUNE SYSTEM
Deposited on 2017-09-12, released 2018-04-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-18, with a file datestamp of 2018-04-13.
Experiment type: XRAY
Resolution: 1.26 Å
R-factor: N/A
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'D':
    Compound: Human T Cell Receptor Alpha Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EH4 (0-203)
    Domains in SCOPe 2.07: d6eh4d1, d6eh4d2
  • Chain 'E':
    Compound: Human T Cell Receptor Beta Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EH4 (0-243)
    Domains in SCOPe 2.07: d6eh4e1, d6eh4e2
  • Heterogens: GOL, EDO, HOH

PDB Chain Sequences:

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6eh4D (D:)
    kqevtqipaalsvpegenlvlncsftdsaiynlqwfrqdpgkgltsllliqssqreqtsg
    rlnasldkssgrstlyiaasqpgdsatylcavtnfnkfyfgsgtklnvkpniqnpdpavy
    qlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksd
    facanafnnsiipedtffpspess
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6eh4E (E:)
    mkagvtqtpryliktrgqqvtlscspisghrsvswyqqtpgqglqflfeyfsetqrnkgn
    fpgrfsgrqfsnsrsemnvstlelgdsalylcassfdsgnsplhfgngtrltvvedlnkv
    fppevavfepseaeishtqkatlvclatgffpdhvelswwvngkevhsgvctdpqplkeq
    palndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeaw
    grad