PDB entry 6eh2

View 6eh2 on RCSB PDB site
Description: crystal structure of the protein-kinase a catalytic subunit from criteculus griseus in complex with compounds rkp032 and amp
Deposited on 2017-09-12, released 2018-10-10
The last revision was dated 2019-05-15, with a file datestamp of 2019-05-10.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-dependent protein kinase catalytic subunit alpha
    Species: Cricetulus griseus [TaxId:10029]
    Gene: PRKACA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25321 (2-352)
      • expression tag (0-1)
  • Chain 'B':
    Compound: camp-dependent protein kinase inhibitor
    Species: Cricetulus griseus, synthetic [TaxId:10029]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EH2 (0-17)
  • Heterogens: AMP, MPD, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6eh2A (A:)
    ghmgnaaaakkgseqesvkeflakakeeflkkwespsqntaqldhfdriktlgtgsfgrv
    mlvkhketgnhyamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnly
    mvmeyvpggemfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqq
    gyiqvtdfgfakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagypp
    ffadqpiqiyekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwf
    attdwiaiyqrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkeftef
    

    Sequence, based on observed residues (ATOM records):
    >6eh2A (A:)
    ghmgnaaaakkgseqesvkeflakakeeflkkwespsqntaqldhfdriktlsfgrvmlv
    khketgnhyamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvm
    eyvpggemfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyi
    qvtdfgfakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffa
    dqpiqiyekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfatt
    dwiaiyqrkveapfipkfkgdtsnfddyeeeeirvekcgkeftef
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6eh2B (B:)
    ttyadfiasgrtgsrnai