PDB entry 6egz

View 6egz on RCSB PDB site
Description: Crystal structure of cytochrome c in complex with di-PEGylated sulfonatocalix[4]arene
Class: electron transport
Keywords: Non-Covalent PEGYlation, sulfonato calix[4]arene, cone and partial cone conformations, ELECTRON TRANSPORT
Deposited on 2017-09-12, released 2018-10-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-08-28, with a file datestamp of 2019-08-23.
Experiment type: XRAY
Resolution: 2.17 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c iso-1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CYC1, YJR048W, J1653
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00044 (0-107)
      • engineered mutation (0)
      • engineered mutation (106)
    Domains in SCOPe 2.08: d6egza_
  • Chain 'B':
    Compound: Cytochrome c iso-1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CYC1, YJR048W, J1653
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00044 (0-107)
      • engineered mutation (0)
      • engineered mutation (106)
    Domains in SCOPe 2.08: d6egzb_
  • Heterogens: HEC, B4X, SO4, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6egzA (A:)
    aefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
    nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6egzB (B:)
    aefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
    nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate