PDB entry 6egy

View 6egy on RCSB PDB site
Description: Crystal structure of cytochrome c in complex with mono-PEGylated sulfonatocalix[4]arene
Class: electron transport
Keywords: Non-Covalent PEGYlation, sulfonato calix[4]arene, cone and partial cone conformations, ELECTRON TRANSPORT
Deposited on 2017-09-12, released 2018-10-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-08-28, with a file datestamp of 2019-08-23.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Cytochrome c iso-1
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Gene: CYC1, YJR048W, J1653
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00044 (0-107)
    • engineered mutation (0)
    • engineered mutation (106)
  Domains in SCOPe 2.08: d6egya_
• Chain 'B':
  Compound: Cytochrome c iso-1
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Gene: CYC1, YJR048W, J1653
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00044 (0-107)
    • engineered mutation (0)
    • engineered mutation (106)
  Domains in SCOPe 2.08: d6egyb_
• Heterogens: HEC, SO4, B4T, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6egyA (A:)
  aefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
  nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6egyB (B:)
  aefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
  nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate